SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006298 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006298
Domain Number 1 Region: 186-386
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-51
Family DBL homology domain (DH-domain) 0.000000356
Further Details:      
 
Domain Number 2 Region: 1-220
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-41
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 
Domain Number 3 Region: 373-535
Classification Level Classification E-value
Superfamily PH domain-like 2.98e-34
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 631-760
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-27
Family SH2 domain 0.00063
Further Details:      
 
Domain Number 5 Region: 779-839
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-22
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 6 Region: 581-658
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000387
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006298   Gene: ENSMGAG00000006230   Transcript: ENSMGAT00000007045
Sequence length 841
Comment pep:known_by_projection chromosome:UMD2:10:12934508:13088375:-1 gene:ENSMGAG00000006230 transcript:ENSMGAT00000007045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCGQWLISCKVLPPNHRVTWDTAQVFDLAQTLRDGVLLCQLLNNLRSHSINLKEINLRPQ
MSQFLCLKNIRTFLSACCEIFGMKKSELFEAFDLFDVRDFGKVIETLSKLSRTPIAIGTG
IRPFPTEESVDDEDVYKCLPDLIDETGVDEDEELYDCVYGEDEGGEVYEDLMKDEAAQQP
KHTENDVRSCCLAEIKQTEEKYTETLESIEKFFMVPLKRFLSASEFETVFINIPDLVKIH
RSLTQDISDSIINKNDQNLYQIFISYKERLVIYGQYCSQVETAISCLDNISKTKEDVKLK
LEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPMEKTNLKLALDAMKDLA
QYVNEVKRDNETLREIRQFQLSIENLNHSLLQYGRPQGDGEIRITTLDKRARQDRHIFLF
DLAVIVCKRRGDNYEMKEIIDLQKYKITNNPTTDKENKKWSYGFYLIHIQGQNGLEVYCK
TKDLKKKWLEQFQMALSNIRPDYADTSFHEFKMHTFSRVTSCKVCQMLLRGTFYQGYLCS
KCGAGAHKECLGRLDNCGRANSGEHGNLKHEKRTNGIRRNSRHVDPGLPRMQVIRNYKGI
PQPAPQDGPPLHIQIGDTIELITGDAHSLFWQGRNLTTGELGFFPSDAVKPSPCVPKPVD
YSSQLWFAGAMERLQAESELINRINSTYLVRHRTKESGEYAISIKYNNEVKHIKILTRDG
YFHIAENRKFKNLMELVDYYKHHSLKEGFRSLDTTLQFPYKESENSVGQRGNRAGGNLLS
PKVIGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEED
E
Download sequence
Identical sequences G1N3J9
ENSMGAP00000006298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]