SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006942 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006942
Domain Number 1 Region: 349-572
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-30
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 100-234,340-423
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.64e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.076
Further Details:      
 
Domain Number 3 Region: 688-718
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000324
Family LIM domain 0.015
Further Details:      
 
Domain Number 4 Region: 656-687
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000111
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006942   Gene: ENSMGAG00000006851   Transcript: ENSMGAT00000007706
Sequence length 1009
Comment pep:known_by_projection chromosome:UMD2:1:80016236:80023279:-1 gene:ENSMGAG00000006851 transcript:ENSMGAT00000007706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTWGSSSYPYCPPRMSTPDEEPTNPAHTLFERFVHARQCQEVLSCFAELCHQLGLQGNGL
QLYHSLKAALNFWSAKALWSKLDKKAGHKDYDQGTACAHTKCLVVGAGPCGLRTAIELTL
LGARVVLLEKRDSFSRNNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLILL
KVALLLGVEVHTKVQFKGLQPPTGKXRYSRAEVEVAEISGVARIYNQKFFQNLYNRTGID
LENIVYYKDDTHYFVMTAKKQSLLKKGVILQDKADIESLLSPDNVNWDALLSYAKEAANF
STNYCLPELEFALNHRNQPDVDMFDFTCMTRSENAALVREHNGARLLLGLVGDCLVEPFW
PLGTGVARGFLAAFDAAWMVRRWAAGTPPLEVLAERESIYQRLSQTSPDNTNKNIAQYSI
DPTTRYPNLNLQAIRPSQVRDFYLIGKVEVDHKKKIDNRLSTAVCGDTYKELLRWCQDST
DGYRGVEVIDFTSSWTSGLALCALIHRFRPHLVDFNAIDPQDPIRTHQLMLDVAEQELGI
QPILSSAEMATMAESNRLGLITYLSQFYEAFKPPPPASTELSKKPLSPCGTKGAILFLSK
LQKSRILTHKRTQASVQKDAEGKKSKRDSTEEEPPAPPNPKDWVTHITQPVLSSHRQSSD
ACYFCARRVYILERASAEGLFFHRSCFQCWRCGATLRLGDYAFNEEDGHFYCSLHFPDTL
SMELLPNKPSMLPDGMLGAPVHPLSRRSPGPPPTSPQPSESGGRRKIILSDLEKLHLSSL
SLMGDTEAEPPPKPARLRLQAPLEAMLGVQAEVAWEEKEEEEEEAAMEEGSSKPTGPTLS
HIKASENLIVGSTEKYPTWKRTLDRRAREAQMKRFCKAQAIQRRLEEIEVTFRELEQQGI
KLEKFLREDTDSPADQKTQWMNQLLYLVQKKNSLMLEESDLMITVQELKLEEQQWQLDQE
LRWYIEKEEALKTPEDRAAEQQILAQLLKVVDKRNALIHMQEEKRLSEL
Download sequence
Identical sequences G1N4Y4
ENSMGAP00000006942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]