SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007665 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007665
Domain Number 1 Region: 524-674
Classification Level Classification E-value
Superfamily EF-hand 8.61e-53
Family Osteonectin 0.00000172
Further Details:      
 
Domain Number 2 Region: 470-521
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000025
Family Ovomucoid domain III-like 0.00079
Further Details:      
 
Domain Number 3 Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family Follistatin (FS) module N-terminal domain, FS-N 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007665   Gene: ENSMGAG00000007541   Transcript: ENSMGAT00000008446
Sequence length 675
Comment pep:known_by_projection chromosome:UMD2:4:26797960:26805705:1 gene:ENSMGAG00000007541 transcript:ENSMGAT00000008446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVVLLICLLGSASTTPTYPLNYQSGAHGQKTAEKTKYTHSENPEEENTGSVNKGNVLS
GHRTIKAEVPVLDTQRDEPWAARREGRSGGEHQTKNSLKSINFLTLHSNPGLASDNWESN
SGSNREQPNSEHHQPRRHKKHGNMAGQQALRGESPADALGLVRELNTWKYNKNAVGLDEN
NSESEEEEAGQEEDEEWGEETDYRDMKHRAHGTSHGSQHRSWQNENSRPSGEFLRDSSLP
MRITKRHGEKFSTEEESQEKPYEEGKLPLSKKNHNEDQGEKRQSQKSKEHFQVNDQHKQE
AVMKRQDKEGSNAEEDDNDSGDDGEEDLSNVWREGVYEEEERMQSNAQDSNSKQKDEGTA
GDDSGVYREMQDYQGDKIKDITHSKDDHYHHEPPNSSSKRQLQKSSSAESMNSTESEDEV
KTTGSSYNEESARNSTGKALPDLCRNFHCKRGKVCQADKQGKPSCICQDPAACPSTKDYE
RVCGTDNKTYDGTCQLFGTKCQLEGTKMGRQLHLDYMGACKYIPHCTDYEVGQFPLRMRD
WLKNILMQYYERDQDKPGFLTEKQRNKVKKIYLNEKRLVSGEHPVELLLHDFEKNYHMYV
YPVHWQFYQLDQHPIDRSLTHSELAPLRASLVPMEHCITRFFQECDGDQDKLITLKEWCH
CFGIKEEDINESLLF
Download sequence
Identical sequences G1N6G1
XP_003205615.1.16129 ENSMGAP00000007665 ENSMGAP00000007665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]