SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007770 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007770
Domain Number 1 Region: 350-489
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-43
Family C-type lectin domain 0.00013
Further Details:      
 
Domain Number 2 Region: 634-780
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-38
Family C-type lectin domain 0.00000581
Further Details:      
 
Domain Number 3 Region: 1219-1363
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-38
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 4 Region: 792-924
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-36
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 5 Region: 931-1084
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-35
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 6 Region: 501-639
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-34
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 7 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.34e-33
Family Cysteine rich domain 0.00000246
Further Details:      
 
Domain Number 8 Region: 1091-1218
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-30
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 228-343
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 2.11e-20
Family Fibronectin type II module 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007770   Gene: ENSMGAG00000007578   Transcript: ENSMGAT00000008552
Sequence length 1456
Comment pep:novel chromosome:UMD2:6:19754072:19801648:-1 gene:ENSMGAG00000007578 transcript:ENSMGAT00000008552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYLPLLVTQTSGISAELSLTDTSTFLIYNEDHKRCVLAQSSNSVTTAPCVQENESQKFRW
VSDHQLMSIAFKLCLGVPSKKDWVPITLYPCDKASELQRWECRNETLFAIQGEDLFFNYG
NRQERNIMLYKGSGLWSRWKVYGTTDDLCSRGYEDTYTVRGNAEGAPCVFPFKFGNKWYA
DCTDAGRADGWFWCGTTADYDVDKRYGFCPLKINSIDSLWNTDPLTNVQYQINSESALTW
HQARKSCQQQKAELLSITELHEQTYLAGLTGKLSSALWFGLNSLNFDSGWQWVGGAPFRY
LNWVPGHPSPEPGKICAALNPGKVAKWENWECNQKLGYICKRGNATLASFIVPTETDVPI
RCPDQWISYAGHCYIIHRDPKIWKDALTSCRKEDGDLASIHNVEEYSFVISQLGYQPDDE
LWIGLNDLKIQMYFEWSDGTPVTYAKWLRGEPTHANNRQEDCVVMKGKDGFWADHSCEKK
IGYICKRKPLSEAPTEEETIAMGCQRGWKRHGFYCYFIGNTFVTFSQANQTCERHQAYLA
TVQDRYEQAYLTSLVGLKTERYFWIGLSDVEEKGTFKWANGEYVLFTHWNSEMPGRKPGC
VAMRTGTAGGLWDVIKCEEKAKFLCKMWAEGVTPPPVPTTTPVPSCPEGWDSNNRISFCF
KPFSKGEQKKTWLESQEFCRTVGGDLASINGKEEQYVIWRSIANNGFYHQHFWMGLYYLN
PDDGFVWSDGSPVRYENWGFGEPNNYQGIELCAEISGDSSMLWNDRHCDYLYGWICQIRK
GASLKPEPTESPVPKYVSTEDGWIINEDRHYYFSTESVPMEKGREFCKQNFGDLAVIESE
TERKFLWRYILKNGKEEAYFIGLQLSVDQRTSWMDGTPVNYLAWAPHEPNFANNDENCVV
MYKNLGFWNDINCGYPNPYICERHNSSINSTLPLTTFSTPRGCNPTWLSFQNKCYKIFGS
TEDERVTWHAARTACMNLGGNLAAIPNEQVQALAFLTFHMKDFLTDTWIGLNDINHELKF
LWTDGTGVYFTNWAKGFPSGHVGSYSYDGQADCVVMRNNPVKEAGKWADESCDNNRGYIC
QIKTDAELLPSTTTDPTSIIRYGNSSYLFIHTKMNWEDARENCKRNQFDLSSILDPYSHS
FLWLKILKYGVPIWIGLNSNVTNGRYEWIDNWRMKYTKWAEGEPKQKIGCVYLDISGSWK
TGSCNESYFSVCKKSDVQAPTEPPQLPGKCPESEGHRSWIPFRGHCYYIESSSTRNWAQA
SLECLRLGASLVSVEDSAEASFLTYIIEPLEGKTSTFWTGMYRNVDGEWLWLDNTVVNFV
NWNTGEPSPQQNEHCVEMYANSGYWNNIYCTSYKGYVCKKLKTSFLKSTYCLYLFSAMTK
DEEAPTLSHGKTGIVVIVVIIILAGSSLAGYLFYKRRKNRLSTNDSFENNLYFNSDGTGD
TKDLVTNIERNEHATL
Download sequence
Identical sequences G1N6N6
ENSMGAP00000007770 ENSMGAP00000007770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]