SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008022 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008022
Domain Number 1 Region: 82-243
Classification Level Classification E-value
Superfamily EF-hand 3.63e-22
Family Calmodulin-like 0.0066
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily EF-hand 0.0000000132
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008022   Gene: ENSMGAG00000007842   Transcript: ENSMGAT00000008811
Sequence length 249
Comment pep:known_by_projection chromosome:UMD2:3:39267593:39289882:-1 gene:ENSMGAG00000007842 transcript:ENSMGAT00000008811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNGYIEGKELDNFFHHLLEKLRPDDTITEEEVQRMKEQFMSAYDVTTDGRLQIQELANMV
LPDDENFLLLFRRETPLDNSVEFMRIWRSYDADSSGFISAGELKDFLRDLFLQHNKVVTE
VKLEEYTDTMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFA
HYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDKFRQILLNHCDVNRDGKIQKSELA
LCLGLKMNP
Download sequence
Identical sequences G1N767
ENSMGAP00000008022 ENSMGAP00000008022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]