SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008460 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008460
Domain Number 1 Region: 442-613
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.93e-51
Family SPRY domain 0.00057
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-17
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 3 Region: 144-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000168
Family B-box zinc-binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008460   Gene: ENSMGAG00000008272   Transcript: ENSMGAT00000009257
Sequence length 620
Comment pep:known_by_projection chromosome:UMD2:20:8787691:8794187:1 gene:ENSMGAG00000008272 transcript:ENSMGAT00000009257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSEPNLLALEEELTCSICLCIFNVPVTVPCGHNFCASCLELTWTDQVRDFSCPQCRTTFP
GRPQLRKNTVLCRVVEQLRAAGPGTGGRTMSARRKSGRRQAPIYCDSCMQAAATHTCLTC
MASFCPEHLRPHHDSPAFRDHQLCPPVRDLQQRKCPQHNKLFEFFCSQHSCCICSLCLLS
HKLCHTNPLQQAKDKAESALKKRLAELHNQSERSVQAMNSVKTIRSQAAETAARKRDLLR
AEFLEIKALIEEKENQTLKVVMEEEKRVCNKFDYIYKILGNKKNEIQSLTEQIEMALTEG
DDILFLKRAAALQRTSIKEAFVPVIEMNHDMIHAAYQSAINLKDVVKLATNLLLKKSLLQ
TVSIEEHHPLLTMALPLKMSSSTYPRAFCSGGDAAINTAPNMGAPNVGAPSTGAPSTGPP
NAAAAAKVKELISSFLKKTRVELLQYAANFTLDFNTAHNRVALSERYTKMFVSDVLLNYN
HHPQRFTDCPQVLGFQCFKRGIHYWEVELQQNNFCGIGICYGSMERQGPNSRLGRNSSSW
CIEWLNSKISAWHNDVEKYLPNTKATKIGVLLHYDGGFVLFLTVEEKLNLIYKFKAQFTE
AVYPAFWLFSSGTVLSLCQM
Download sequence
Identical sequences G1N861
ENSMGAP00000008460 ENSMGAP00000008460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]