SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008800 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008800
Domain Number 1 Region: 19-366
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.99e-137
Family Calpain large subunit, catalytic domain (domain II) 0.000000000135
Further Details:      
 
Domain Number 2 Region: 370-529
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.22e-53
Family Calpain large subunit, middle domain (domain III) 0.0000014
Further Details:      
 
Domain Number 3 Region: 539-713
Classification Level Classification E-value
Superfamily EF-hand 1.27e-44
Family Penta-EF-hand proteins 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008800   Gene: ENSMGAG00000008330   Transcript: ENSMGAT00000009604
Sequence length 716
Comment pep:known_by_projection chromosome:UMD2:2:17575206:17603285:1 gene:ENSMGAG00000008330 transcript:ENSMGAT00000009604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPYTSSAPADRGSMAGLAARLCQERAAAEGLGSCRKALSYLGQDYEALRQKCLQAGTLF
KDEEFPACPSALGYQDLGPYSFKTQGIVWKRPTDLCDNPQFIVGGATRTDVCQGELGDCW
LLAAIASLTLNPDVLHRVVPEAQSFQEDYAGIFHFQFWQYGEWVDVVVDDRLPTKNGELL
FVHSEEGNEFWSALLEKAYAKLNGSYEALAGGSTIEGFEDFTGGISESYDLRRAPANLYQ
IVQKALRAGSLLGCSIDITCAAETEAITSLKLVKGHAYSVTGAEEVYYQGQPEKLVRLRN
PWGEVEWTGAWSDNAREWNYIDPKQKQALDKQVDDGEFWMAFSDFQRQFTRLEICNLTPD
TLTSNQVNKWDLTVFNGQWIRGSTAGGCQNYPATYWINPQFKIRLDEPDDDHEGSLNEPC
CTILVGLMQKNRRRQKRMGEGLLSIGYSLYQIPQELENNKDIHLNRAFFTRNQPIARSET
YINLREVSSRIKLPKGEYLIVPSTFEPYKNGEFCLRVFSEKKVKTQMIGDMVAAKPYEPH
VDNKDIDDEFKTLFQKLSGEDCEVTATELQTILNRVLAKRKDIRSDGFNINTCREMISLL
DTNGTGSLGLIEFKTLWMKIQMYLAIYRKVDRDYSGTIDSHEMRNALSEAGFVLNNQVQQ
SIAIRYACSKMTIDFDGFVACMIRLETLFKVFHLLDKEKSGVVQLSLAEWLCCTLV
Download sequence
Identical sequences G1N8W2
ENSMGAP00000008800 ENSMGAP00000008800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]