SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009711 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009711
Domain Number 1 Region: 7-90
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-22
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009711   Gene: ENSMGAG00000009406   Transcript: ENSMGAT00000010543
Sequence length 640
Comment pep:known_by_projection chromosome:UMD2:1:30159651:30178579:1 gene:ENSMGAG00000009406 transcript:ENSMGAT00000010543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLHLDEVELCRIGSQEKLGLTVCYRTDDEEDTGIYVSEVDPNSIAARDGRIREGDRILQI
NGQDVQNREEAVALLSSDECKKIVLLVARPELQLEEGWLDDERNEFLEELNLEMLEEQHN
EAMQYTANEVEQPKKHEEEDGTTDTATSSSNNHEKDSGVGPTDESLRNDESSEQENAPEE
QNGATLQSKRELGHSQDTLGSVELQCNESFVSGEYIESDFIGNPEEECERFRQLLELKCK
IRNHGEYDLYYSSSTIECNRREQDGVEHELQLLNEELRNIELECQNIMQAHRLQKVRDQY
GDIWALHDEGFRNYNTSIDVQRGKLDDILEHPEKSDKDSSSAYNTAESCRSTPLTVERSP
DNSLQRMISITNRKNLRSTIVANQSSSGQSNKETISVKTKPTEQNSTAEDTVLASENSKF
TDQEKQSTEHIPYLSPYHSSSYRYGNIPAHAKHYQSYMQLIQQKSAVEYAQSQLSLVSMC
KDSQKCAEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMK
MGRYWSKEERKQHLVRAKEQRRRREFMMRSRLECLKESPQSGSEGKKEINIIELSHKKMM
KKRNKKILDNWMTIQELMTHGAKSPDGTRVHNAFLSVTTV
Download sequence
Identical sequences G1NAW8
ENSMGAP00000009711 ENSMGAP00000009711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]