SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010289 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010289
Domain Number 1 Region: 498-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-57
Family Protein kinases, catalytic subunit 0.00000957
Further Details:      
 
Domain Number 2 Region: 236-301
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010289   Gene: ENSMGAG00000009939   Transcript: ENSMGAT00000011139
Sequence length 805
Comment pep:known_by_projection chromosome:UMD2:17:11714905:11757534:1 gene:ENSMGAG00000009939 transcript:ENSMGAT00000011139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSLSCLRSVHKSGGSLSKQDWTIQWPTTEPGKENQPGCPQEPAPWSRTHLSASPNPAKCA
QHHCHGPLYTHVDRLTVEGHPGLCPPVESGHRSLPPSPRQRHAAHTPPRTPNIVTTMTPP
GTPPLRRRNKLKPPGTPPPASRKLIHLLPGFTALHRSKSHEFQLGHRVDEAHTPKTKKKN
KPLNLKIHNSVGSCENIPAQRSPLLSERSLRSFFVGYPPFLPSTPPVHTEATFSANTLSV
PRWSPQIPRRDLGNSIKHRFSTKYWMSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPP
CHLLIIHRGASASRDALARFPTARARLVRTESVPCDINNPLRKPPRYSDLHVSQTLPKTN
KLNKDHIPVPYQPDSSSNPSSTTSSTPSSPAPPLPPSATPPSPLHPSPQCPRQQKQFNLP
ASHYYKYKQQFIFPDVVPETPTRAPQVVLHPVTSNPILEGNPLLQIEVEPTSENEEGTEE
AQESEDDFEEMNLSLLSTRNFPRKASQTSIFLQEWDIPFEQLEIGELIGKGRFGQVFHGR
WHGEVAIRLIDIERDNEDQLKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKG
RTLYSVVRDAKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVFYDNGKVVITDF
GLFSISGVLQAGRRENKLRIQNGWLCHLAPEIIRQLSPDTEEDKLPFSKHSDVFALGTIW
YELHAREWPFKTQPAEAIIWQVGRGMKPNLSQIGMGKEISDILLFCWAYEQEERPTFTKL
MDMLEKLPKRNRRLSHPGHFWKSAE
Download sequence
Identical sequences G1NC56
ENSMGAP00000010289 ENSMGAP00000010289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]