SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010357 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010357
Domain Number 1 Region: 435-656
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-57
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 231-356
Classification Level Classification E-value
Superfamily BRCT domain 4.8e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.058
Further Details:      
 
Domain Number 3 Region: 132-250
Classification Level Classification E-value
Superfamily BRCT domain 9.6e-20
Family DNA ligase 0.04
Further Details:      
 
Domain Number 4 Region: 648-793
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000283
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010357   Gene: ENSMGAG00000009941   Transcript: ENSMGAT00000011212
Sequence length 914
Comment pep:known_by_projection chromosome:UMD2:11:19322224:19346387:-1 gene:ENSMGAG00000009941 transcript:ENSMGAT00000011212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNSTLVSESGRSLLADTSVLDSKIVENSKENVLPGSVVDVEEEMPQIETRVVLVQEAG
KREELLKALETIRIMEVPVIKIKETSPGKSEEKLIKSIAHMEIKVPYIKTNTIEELGDCD
SPEFETVFVVTDFQGSIFNNLCKADCRVIGPPVVLHCAQKGEPLPFSCRPLYCASMLNLV
LCFTGFRKKDELVKLVTLVHHMGGIIRKDFNSKVTHLVANSTHGDKFRIAVSLGTPIMKA
EWIYKAWEKRNEMDFCAADDDIRNQFKVPPFQDCLLSFLGFSDEEKANMEEMTEMQGGCY
LPVGDERCTHLVVEESTVKEIPFEPLKKLYIVKQEWFWGSIQMDARAGESMYLFEKSESP
GLKKSVSQLSLSTPNSNRKRRRLKETLAQLTRETDMSPFPPRKRPSAEHSLSLGSLLDIS
NTPESSTTNGETPKSCARPSKNSTPLPLKQSARWQVAKELYQTESNYVDILTTIIQLFQV
PLEKEGQLGGPILAQEEIKTIFGSIPDILDVHTKIKEDLEDLMVNWTESKSIGDIFLKYS
KDLLKTYPPFVNFFEMSKETITRCEKQKPRFHAFLKINQAKPECGRQSLAELLIRPVQRL
PSVVLLLNDLKKHTAEDNPDKIILERAIESLKEVMTHINEDKRKTEAQRQFFDVVYEVDG
CPANLLSSHRSLVQRLETVALGDDLCDRGEQVTLFLFNDCLEIARKRHKVIGAFKSPHGH
TRPPASLKHVVLMPLSQIKKVLDIRETEDCHKAFALVVRPPTEHNNKLLSFQMTSEEPPK
EDWLKTLCRHVANTICKADAENLIYAADPDSVEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMSHSATEGRSPSSANESYIGSRLNSTSSLAGISSPSLVSLPSIFE
KRSHTLSRSTTHLI
Download sequence
Identical sequences G1NCA6
ENSMGAP00000010357 ENSMGAP00000010357 XP_010715194.1.16129 XP_010715195.1.16129 XP_010715196.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]