SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011093 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011093
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily PX domain 6.28e-31
Family PX domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011093   Gene: ENSMGAG00000010674   Transcript: ENSMGAT00000011962
Sequence length 200
Comment pep:known_by_projection chromosome:UMD2:6:32629621:32648489:1 gene:ENSMGAG00000010674 transcript:ENSMGAT00000011962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPKHEKQEFVTVLVRDPRTQKEDSWHSYIDYEIFIHTNSMCFTRKTSCVRRRFREFVWL
RQRLQSNAVLIQLPELPSKTPFFNMNNPHHVDHRRQGLQEFLEKILQNALLLSDSRLHLF
LQTQLSPEDMEACVSGQTKYSVADAIQKFASLNRRFPIEDEERKKGNDADSDSESSSSGL
GPSDDSISCGCKASLASEES
Download sequence
Identical sequences G1NDX9
ENSMGAP00000011093 ENSMGAP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]