SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011498 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011498
Domain Number 1 Region: 253-345
Classification Level Classification E-value
Superfamily EF-hand 5.23e-26
Family Eps15 homology domain (EH domain) 0.0000138
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily EF-hand 4.62e-24
Family Eps15 homology domain (EH domain) 0.00000873
Further Details:      
 
Domain Number 3 Region: 11-103
Classification Level Classification E-value
Superfamily EF-hand 1.3e-18
Family Eps15 homology domain (EH domain) 0.0000267
Further Details:      
 
Domain Number 4 Region: 371-480
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000011
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011498   Gene: ENSMGAG00000010996   Transcript: ENSMGAT00000012375
Sequence length 918
Comment pep:known_by_projection chromosome:UMD2:10:24824600:24861587:-1 gene:ENSMGAG00000010996 transcript:ENSMGAT00000012375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGAEMQIFMLSSANPVYEKFYRQVDSANTGRVLASDAAVFLKKSGLTDLVLGKIWDLADT
DSKGILNKQEFFVALRLVACAQNGLDVSLSSLNLPVPPPRFTDTSSPLLLSGTASSDIPW
AVKLEDKAKYDAIFDSLNPVNGLLSGDKVKPVLLNSKLPVDILGRVWELSDIDRDGMLDR
DEFAVAMFLVYCALEKEPVPMSLPAALVPLSKRKPVSVPGAMPLIPSSASSKDSHQSLPP
VGILAAKTPLTQWVVSPADKIKYDEIFVKTDKDMDGFVSGVEARELFLKTGLPSALLAHI
WALCDTKDCGKLSKEQFALAFYLINQKLTKGIDPPQALTPEMIPPSDRSVTLQKNVQGLN
SVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVKRESSNL
QKLQAQKQEAQEILNDLDEQKAKLEEQLNDIRQKCAEEAHLIAMLKAEITSQESKISAYE
DELTKAQEELSRLQQETAELEHCIESGKAQLGPLQQHLQDSQQEINSVQTKLLELKELES
NQFSWHSQPQTVLVNGTADHSSLSNSSSETANLNENAERESIAEDEQINNVSPTRNSPET
TAAAAEEDKETPSATVTKKEDPFDAESHPLPDIVSETSLEFFQSDPFVGSDPFKDDPFGK
IDPFGGDPFKGSDPFAADCFFKQSSTDPFVTAGTDPFSAAINSNNSTTEIPKKNDPFAPG
GTTVTTSNDSATDPFASLFGNESFGSGFADFSTMSKANNEDPFGSSTSGSVKNVVITKNS
FEEPPAKNEDVPPALPPKTGTPTRPCPPPPGKRPINQIDSSDSFKPRDPFQPFPTPEIPK
EQEADLFCDPFAPTSIGKEADPNNFANFSTYSTEEDMIEWAKRESEREEKERLARLKQQE
QEDLELAIALSKSELSEA
Download sequence
Identical sequences G1NEV6
ENSMGAP00000011498 ENSMGAP00000011498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]