SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011580 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011580
Domain Number 1 Region: 221-352
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-32
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 2 Region: 364-496
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-32
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 3 Region: 1248-1377
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-29
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 4 Region: 1114-1234
Classification Level Classification E-value
Superfamily C-type lectin-like 5.23e-28
Family C-type lectin domain 0.0029
Further Details:      
 
Domain Number 5 Region: 809-934
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-28
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 503-641
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-28
Family C-type lectin domain 0.00069
Further Details:      
 
Domain Number 7 Region: 658-795
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-26
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 8 Region: 36-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.25e-23
Family Cysteine rich domain 0.014
Further Details:      
 
Domain Number 9 Region: 950-1098
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-21
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 10 Region: 162-217
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-18
Family Fibronectin type II module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011580   Gene: ENSMGAG00000011095   Transcript: ENSMGAT00000012458
Sequence length 1459
Comment pep:known_by_projection chromosome:UMD2:7:22958392:22993505:1 gene:ENSMGAG00000011095 transcript:ENSMGAT00000012458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKQYPSLMLFSMFVDRGCVACVACGLGWTRIFPCTDKGIFIIQSSDSNLCIKVDTAGLIL
EDCSQLSKNMLWKWVSNRRLFNIGRSTCLGLNISRPEQPLTMLECDSNQYSLWWNCDGRA
LVGVSEYKLAVENSKRIIAQKKSNYQWIQYMSYDEDLCEHPFQETYTLLGNSFGFPCVFP
FKYNNKWYYECTRDGKEFEWCATTSHYEQDEKWGFCPSAAEHGCGTFWKENPATHACYQF
NPSAVLSWHEARAACQAQGGDLLSITSPEEQSYVSDLSHNVLWTGLNRLEEGAGWQWSDG
APLVFVNWRADVSEDRSGENHCAVMSSKLKYGWKSYLCESGFPFVCKKYLNKTEHKTLVK
DTWKYYATRCDAGWYPYNRNCYRLHKEGKSWNDALISCQSDSSGLISISSMADAELLHNL
LQRENITETWIGLYSSNVSVVFEWSDGTPVKFSYWHSQEPSTFQRIGQLCVSAQGPEGHW
KVKKCEDKSFYICKKAGEINSVSSDAESSCPEGWERHGGYCYKIDSTPRSFEHASSGYFC
PSALVSVTNRFEQAFITSMIRSVVKSERTYFWIGLQDLNNTGEYFWLTTDGKNHSVSYTN
WNKYQPRHSGGCVAMRGQDPVGYWEVKSCKNFKAMSLCKQKVNSYEEPELTFQRHLSSCY
FGWESEGNLLNCYKIFHREKVLMKRTWSEAEALCQDFGAHLASFSHVYEETFLNNLLYTI
FDRTEERQFWIGFNKRNPFSGGTWQWSDRTPVVASFLESKYVEDDSRNCGVFKVNRTVFP
AHCNEKREWICKIPKGVKPKNPDWYIAELPWSYYQGAEYLFHVNPTDWDTYEFICVWLRS
EMATINSAEEQAFIENKIKKLSDSDVHWWIGLHAENISNEFRWKDESLVTYQNWNEGRDR
YLHKPGKRCGFISSQTGRWDDENCTVSLPCICKRKNAWKIEKEIPKDRNPQGMCPKGWLH
FGLKKQCFLIQIPKDPEHLRSWYSAQTFCSRYDGSLASLEDELEQAFITMNLFGRKTSVW
IAFQGDDYEKWMNENPPRYSNWSPIEVVHRPRYNSVYVEEQVPLCTLVSNNPNFYFTGKW
YLENCEKNYGFVCQKRQDTSRHIVNASEMYPVPDTLQYANRTYTLIRGNLTWSAALKTCM
ANGAELVSIADQYHQAFLTIIVNRLGYNHWIGLFTADNGLNFEWSDGTRSLFTFWEDDES
QALGSCVYMDTSGHWKSTSCEQILPGAVCHVPPKKKLIKYKGLCSEKHVPWIKFKNNCYS
FNTVLQGTSFDTAYEVCRNQGSNLLTIEDEDENAFILEELHSFGYSVKMVWLNVLHVKDN
ETVSWFDGSPLNYSNWGIREPEFDHLKGNFCISLRTADGVWQISPCREIKGFVCKKDADL
NAAEPSEKSSYSGLAALAVLVTLVMLAAISIFLWCLYKQNNRFFSRILWVRNAYFPQINS
DVPALEESILISDFEKDDN
Download sequence
Identical sequences G1NF25
ENSMGAP00000011580 ENSMGAP00000011580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]