SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011804 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011804
Domain Number 1 Region: 372-634
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-56
Family YWTD domain 0.0000000198
Further Details:      
 
Domain Number 2 Region: 288-365,635-686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 84-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 119-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 5 Region: 167-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 6 Region: 203-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 7 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 8 Region: 38-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 9 Region: 249-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011804   Gene: ENSMGAG00000011284   Transcript: ENSMGAT00000012685
Sequence length 850
Comment pep:known_by_projection chromosome:UMD2:10:25431719:25494258:-1 gene:ENSMGAG00000011284 transcript:ENSMGAT00000012685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKTCAESDFACDNGHCIPDRWKCDGEEECSDGSDESEAACTKQVCPAEKISCGDLSNKCI
PSSWRCDGQKDCESGIDEAGCAPACSPDEFQCSNKTCISINFVCDGYNNCGDGSDERKCS
PLTCSPNEFQCNNSVCIPELWVCDNQADCEDHSDESVERCGYDAKAFNTCAAHEFQCGNG
ECILLNWKCDGDEDCKDKSDEQDCPLVTCRPDEFQCGDGTCIHGAKQCDKVHDCPDNSDE
AGCVQESACESPSKFQCKSGECIDGGKVCDSHRDCRDWSDEPLKECGINECSMNNGGCSH
ICKDLKIGYECECPPGYKLLDKKTCGDIDECENPDACSQICINYKGDYKCECYEGYEMDT
LSKNCKAVGKSPYLIFTNRHEVRKIDLVKRDYSRIIPMLKNVVALDVEVATNRIYWCDLF
YRKIYSAYIDKASDTAEQVILIDSQLNSPEGLAIDWVHKNIYWTDSGNKTISVATADGSR
RKTLFNSDLSEPRAIAVDPTRRFMYWSDWGDKAKIEKAGLNGVGRQMLVSDNIEWPNGIT
LDLLNQRLYWVDSKLHSLSCIDFNGSNRKVLISSVDDLSHPFGLAVFEDRVFWTDLENEA
IFSANRLSGLDISVLAENLNNPHDIVVFHELKQPKAPDSCELSPQPNGGCEYLCLPAPHI
SPHSPKYTCACPDNMWLGPDMKKCYKDLPTTPATTVVPTTTASHPVTTSTVTVTGSANTT
AAAIPGAASEAVPSSHSTASILIDSEMTTGNSNLSQHYSNNGQGFDSTVTAAVIGIVIPI
VVIGLLCMGGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDEIHIGRTAQIGHVYPARV
ALSLEDDGLP
Download sequence
Identical sequences G1NFK8
ENSMGAP00000011804 ENSMGAP00000011804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]