SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011844 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011844
Domain Number 1 Region: 647-842
Classification Level Classification E-value
Superfamily Sec7 domain 3.14e-76
Family Sec7 domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 404-587,1147-1493
Classification Level Classification E-value
Superfamily ARM repeat 4.32e-27
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011844   Gene: ENSMGAG00000011317   Transcript: ENSMGAT00000012726
Sequence length 1805
Comment pep:known_by_projection chromosome:UMD2:3:65617438:65674253:-1 gene:ENSMGAG00000011317 transcript:ENSMGAT00000012726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIKTETEKQSPPHGEAKPGSSTLPPVKSKTSFIEADKYFLPFELACQSKCPRIVSTSLD
CLQKLIAYGHLTGNAPDSTAPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTS
QHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQME
KERHRQQHHLQQSPVSQHEPESPPLRHIPTQADQLSKEHERELDHNTNDVDKNLQEDIET
ENGSDISSAENEQTEADQATAAENLSKADGETYDDESSECEEKAQEIVESIVQEMVNIVV
GDIEGSAESASGDGTIVTLEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQE
SGNSSGPTPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLS
ILQNAGPVFRTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQ
IEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQ
EKPTEQDSNETKHPETINRYGSLNSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEII
EQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEV
MYAYVDQHDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASAD
TAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKI
SMKETKELTIPTKSSKQSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHL
EHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFNIQLERDAYVQA
LARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGT
GVKPRYISGTVRGREGSFTGTKDQAPDEFVGLGLGVGGNVDWKQIASIQESIGETSSQSV
VVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSATHPRMFSLQKIVEISYYNMGRIR
LQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFE
HIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTT
GHIVTIVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAF
KEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEK
HWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDI
FAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCTCMLDIFKTTIPHALLT
WKPVSGGFGPVSPSDAKEKLLARVRYKSAFLSSALKMQSIKNCALLTVLYQNKLKNSFKE
VREFPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVHVD
TQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQET
SSLACGLRILFRMYMDESRTSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLF
LTKVLKISDERFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEHES
AISKQ
Download sequence
Identical sequences G1NFP2
ENSMGAP00000011844 ENSMGAP00000011844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]