SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011933 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011933
Domain Number 1 Region: 881-1093
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-54
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 1256-1442
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-26
Family Pleckstrin-homology domain (PH domain) 0.0000135
Further Details:      
 
Domain Number 3 Region: 1082-1203
Classification Level Classification E-value
Superfamily PH domain-like 6.54e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011933   Gene: ENSMGAG00000011399   Transcript: ENSMGAT00000012815
Sequence length 1446
Comment pep:known_by_projection chromosome:UMD2:1:46174824:46230643:-1 gene:ENSMGAG00000011399 transcript:ENSMGAT00000012815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPSFLEIKKPPVAPKPKFVVGHKATPPPVAPKPDVMLSGVLQAARKTKPAVAPKPKVLKS
SSIPEVKPPSCARKGTKSFEEHRGDSSQTLDHLNYKNEVSEGGTDNTAYILPMSSCKFEC
FHKLGNGENTCKTQIILEHFENLENIKTGEKTALALGSSPSEKMANRNQVVVKASILEEK
LKDVLTHGVFPNRSPVRHRNADKLYKGDGNSSRNDVKIEFLELVQSSSEIANGRQQNTGS
KLTEDEFQTSETCPSLNENHSSCSCPPNQEILENENVNSSSLFSGEMGVKIDTDKTSSET
CSVLSSKMLPIPKPRKPRAACLVRQDGIDSIGEGTKEPSSSENDSLGPAECSFKKPAKIN
VLGQSVCYNDHTEALNPEKSEITQSVTDRMHLRKEPADTEESTLQNLLPQLSHKTSDLVE
NVECSLDIDHNLGSSVDRMTDDASMPDTVDKRTSFIRCDTLSMSLPKQIKLTGSQHPPTA
NSLHVSLQKVEDREAKIKDESSPKIVPKKPQRHSLPAAGVLKKAASAELIEKSSYASSED
KSSSVLEGSHFTRTQAREQGALSSCDIPKRSSEKPVWKLPHPILPFSGNSESLKTASIAP
SFSHVSAVTKPRAKSLSSVDMERTDKPCKDPQKKNSLKKFLNVKLSVCLMKSDFQKFLSK
GSQSMDSSTANLSTGEGYGNGNNRHVSSVGSERKAKSAKARSVEISSPALQKKRQRNRSQ
PEMRSNQRLESSDGHSLPGDNLSQMHLNSVTSNCAPEYENLRHYEEIPEYENLPFAMGAG
KNLSLEWQNSSHVEDPSPSLYEMEEPFQAASRRVRHGRNHQFNSSGLRSLEEHHDHPGMV
IGDLQSDEEDIMNSSDEDDDTNSDSSKGEPDSQDQEKKGKAAGKKTKVYHIAKEIMSSEK
VFVDVLKLLHIDFRDAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLRELEERLS
HWLEHQRIADIFVKKGPYLKMYSTYIKEFDKNIALLDEQCKKNAGFASVVKDFEMSPRCA
SLALKHYLLKPVQRIPQYRLLLTDYLKNLLEESADYRDTQDALAVVIEVANHANDIMKQG
DNFQKLMQIQYSLNGHHEIVQPGRIFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQS
GMYKLNNMLSLAGMKVKKPSQEAYQNELNIESVERSFILSASSATERDEWLEAISRSIED
YTKKRITFNPSKSLEEADTEKQEETSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHC
RACGKIVCQACSSNKHGLDYMKNQPARVCDHCFRELQKQDNQCSSKTGSPVNHKSPSSAL
STVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYLHRSKGSKKPWKHLWFVIKNKVLYT
YAASEDVAALESQPLLGFTVSEVRDENSESRVFHLLHKNTLFYIFKADDPHSAQKWIEAF
QEGTVL
Download sequence
Identical sequences G1NFW6
ENSMGAP00000011933 ENSMGAP00000011933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]