SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012412 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012412
Domain Number 1 Region: 869-1142
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-65
Family Protein kinases, catalytic subunit 0.0000107
Further Details:      
 
Domain Number 2 Region: 563-845
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-45
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 430-541,571-597
Classification Level Classification E-value
Superfamily SH2 domain 1.99e-16
Family SH2 domain 0.0036
Further Details:      
 
Domain Number 4 Region: 148-280
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000596
Family Second domain of FERM 0.0062
Further Details:      
 
Domain Number 5 Region: 361-421
Classification Level Classification E-value
Superfamily PH domain-like 0.000000135
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012412   Gene: ENSMGAG00000011807   Transcript: ENSMGAT00000013302
Sequence length 1151
Comment pep:known_by_projection chromosome:UMD2:10:29386891:29412349:-1 gene:ENSMGAG00000011807 transcript:ENSMGAT00000013302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNVKEDCKAMAFCAKMRSTKKSEVNLEAQHQGLEILFYLQDKSPISYTSGEFTSEEL
CIEAAQKCSISPLCHNLFALFDENRKLWYAPNQVFKIDEKTSHRLYYRMRYYFTNWHGTS
ENEPSVWRHTPKKAKNSYDKKLAPEGTPILDANSLEYIFAQGQYDLVKGLAPIRDPKNDQ
EVHEIENECLGMAVLAISHYAIKKNVKLPELPKDISYKHYIPETLNKTIRQRNFLTRIRI
NNVFKHFLKEFNNKTICDSSVSPRDLKVKYLSTMETLTKYYGAEIFETSSLLISSESEIN
RFNCGDGEIIPLYEVIVTGNNGIQWRLKPNSVQTEKEKKKKSDGKIKKDEDRYKTRDLWN
NFSYFPEITHIVIKESTVSINKQDNKKMELKLSSHDEALSFASLIDGYFRLTADAHHYLC
TDVAPPLIEHNIKNGCHGPICTEYAINKLRQEGNEAGMYVLRWSCTNFNHILMTVTCLEG
PEMINNSVQYKNFQIEVKKGGYFLHGSNRSFASLKELMDHLKGQILRTDNISFTLKRCCQ
PKPREISNLLVATKKAQECQPAYHLGQLSFHRIRKEEIMQGEHLGRGTRTQIYSGILNYK
DDENEGYQNEKEIKVLLKVLDPSHRDISLAFFEAASMMRQVSHKHIVFLHGVCVRDLENI
MVEEFVEFGPLDLFMHRKSELLTTPWKFNVAKQLASALSYLEDKDLVHGNVCTKNILLAR
EGIDTEYGPFIKLSDPGIPITVLSRQECVERIPWIAPECVEDSKNLSIAADKWSFGTTLW
EICYNGETPLKDKTLAEKERFYEGHFMLITPSCKELADLMKQCMNYDPHQRPFFRAIMRD
INKLEEQNPDIVSEKKPVTEVDPTLFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQ
VAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSL
KEYLPRNKNKINLKQLLRYAVQICKGMDYLGSRQYVHRDLAANVLVESENRVKIGDFGLT
KAIETDKEYYTVKDDLDSPVFWYAPECLIQSKFYIASDVWSFGVTLYELLTYCDSESSPM
TEFLKMIGPTQGQMTVARLVRVLQEEKRLPRPPNCPEEIDQLMRKCWIFKHDKRTTFHNL
IQGFETIMSKM
Download sequence
Identical sequences G1NGZ6
ENSMGAP00000012412 ENSMGAP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]