SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012493 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012493
Domain Number 1 Region: 94-225
Classification Level Classification E-value
Superfamily EF-hand 2.59e-24
Family Calmodulin-like 0.023
Further Details:      
 
Domain Number 2 Region: 21-127
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000215
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012493   Gene: ENSMGAG00000011897   Transcript: ENSMGAT00000013389
Sequence length 258
Comment pep:known_by_projection chromosome:UMD2:3:74942446:74972861:-1 gene:ENSMGAG00000011897 transcript:ENSMGAT00000013389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKSGESLEGAVTASVTLFVVGNGYMDGKELQNFIQELQQARKKAGLDLTPEMKAFVDQYG
KATDGKIGIVELAQVLPTEENFLLFFRCQQLKSSEDFMQTWRKYDSDHSGFIDSEELKSF
LKDLLQKANKQIEDSKLTEYTEIMLRMFDANNDGKLELTELASLQRLLPVQENFLIKFQG
VKMCAKEFNKAFEMYDQDGNGYIDENELDALLKDLCEKNKKELDINNLATYKKSIMALSD
GGKLYRAELALILCAEEN
Download sequence
Identical sequences G1NH64
ENSMGAP00000012493 ENSMGAP00000012493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]