SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012626 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012626
Domain Number 1 Region: 253-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-81
Family Protein kinases, catalytic subunit 0.0000000168
Further Details:      
 
Domain Number 2 Region: 127-255
Classification Level Classification E-value
Superfamily SH2 domain 6.69e-32
Family SH2 domain 0.0000334
Further Details:      
 
Domain Number 3 Region: 77-150
Classification Level Classification E-value
Superfamily SH3-domain 5.81e-17
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012626   Gene: ENSMGAG00000012022   Transcript: ENSMGAT00000013522
Sequence length 536
Comment pep:known_by_projection chromosome:UMD2:4:49320824:49333612:1 gene:ENSMGAG00000012022 transcript:ENSMGAT00000013522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFTDHTIQSVFCCCCCCAVQKRIRAMRTKINVDSDTDLETQYSASQSEDSHAPTWKCK
LLRCYRSRGIIQEIENKPLPPLPAEAFEDYTKKLKVIALYDFFARGPSDLTLKQSEEYII
LEQYDPHWWKARDQYGNEGLIPSNYVTENTKSNLETYEWYCKNINRSQAELLLRQKSKEG
SFVVRDSSQQGILTLSVYSRSKGSHGGDIRHYQIKKNHLKQYYVAEKYLFSSIPELIQYH
QHNAAGLITRLRHPVRSIRCSSPATAGFSYEEWELNPSELTFMKELGRGQFGIVHLGKWK
ATIKVAIKKINEGAMSEDDFMEEAKLMMKLSHPKLVQLYGVCTRQKPLYVVTEFLENGCL
LNYLRQWRGKLSRDMLLGMCLDVCEGMEYLERNNFIHRDLAARNCLVNAEHTVKVSDFGM
ARYVIDDEYVSSSGAKFPIKWSSPEVFHFKKYSSKSDIWSFGVLMWEVFTEGKMPFESKS
NYEVVHEISAGNRLYRPHLASHTVYKVMYSCWHEKPEGRPTFAELVETLTDIMEMG
Download sequence
Identical sequences G1NHH0
ENSMGAP00000012626 ENSMGAP00000012626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]