SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013023 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013023
Domain Number 1 Region: 874-1054
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.17e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 1029-1148
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 171-194,231-380
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-25
Family Phosphotyrosine-binding domain (PTB) 0.0064
Further Details:      
 
Domain Number 4 Region: 12-158
Classification Level Classification E-value
Superfamily PH domain-like 3.83e-17
Family Phosphotyrosine-binding domain (PTB) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013023   Gene: ENSMGAG00000012368   Transcript: ENSMGAT00000013925
Sequence length 1266
Comment pep:known_by_projection chromosome:UMD2:4:52650285:52738156:-1 gene:ENSMGAG00000012368 transcript:ENSMGAT00000013925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFKAKKYQAPSDFSASFTLQLVGSLPVHSLTTTSMLPWIVAEIRALSSTKSSKEEL
GISQIRLYVSPSSLRCEPDTGKIQQWDPLICPGLFEHKPQHVHKLIHNSHDPSYIACLIK
DGAENQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFQNNLSDIEDPFAKKFEVLFC
GRVTVAHKNAPPALIDECIEKFNHASCTKKSDSDSSSQQHPLMGEEEEKRPIRKSFSQPG
LRSLAFKKDFQEGSHRSNSFVRSFEEDAISLNLKSQLIYGHSVVQPTDIAENRTMLFTIG
QSEVYLISPDTKKAIEKSFKEISFCSQGIRHVDHFGFICRESSENGGFHFVCYVFQCTDE
ALVDEIMMTLKQAFTVAAVQQTSKAQPQLCETCPLQSLHKLCEKIEGLHPSKTKLELQKH
LTTLNSQEQASVFEEVKKLRPRNDQKENELIISILRNMYEEKQKDHVHVGETKQTSQPSA
ENAVSEVPSSAPRFRLDMLKNKAKRSLTESFESILSRGSKARGPLDNSSGSVDLEASVPN
TLSSTNKEPPLSERETDRLPTVPPENAVKASGSMGDLSSDPDSYALDHSDTLPQQSFRRR
ANTLSHLPSESRESLVPVETSPSVPQRKLMRYHSVSTETPHKRNLNTSVGEPKSSSGQLA
RSPTLARLNPSASSPNFFKYLRHNSSGEQSGHFAQKSISYRTALRKKLHSSSSVPNFLKF
LAPVDENNTSDFRSTTSDYESKHSQQAVGADSPVRTRRHSWRQQIFLRVATPQKACDSPS
RYDDYTELGELPPRSPLEPVCEDGPFGPVKEERKRTSRELRELWKKAIIQQILLLRMEKE
NQKLQASENNLQNRRLKLDYEEITPCLKEVTLIWEKMLSTPGRSKIKFDVEKIHSAVGQG
VPRHHRGEIWKFLAEQYHLKHQFPNKQQPKDTPYKELLKQLTSQQHAILIDLGRTFPTHP
YFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGVLLLHMSEEDAFKMLKFLMFDV
GLRKQYRPDMTILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTMFASQFPL
GFVARVFDMLFLQGSEAIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEK
TISQVFEMDIAKQLQAYEVEYHVLQDELIDSSLNDNQRLDKLEKANSSLRKQNFELLEEL
QGGLMKIQNLEATVELLLTNEGKLKESILNLEQERTALQKAVEEMQKKTGDTNEKPLLTR
QEHLDA
Download sequence
Identical sequences G1NID6
ENSMGAP00000013023 ENSMGAP00000013023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]