SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013352 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013352
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000543
Family Parvalbumin 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013352   Gene: ENSMGAG00000012672   Transcript: ENSMGAT00000014256
Sequence length 65
Comment pep:known_by_projection chromosome:UMD2:1:49727834:49729929:-1 gene:ENSMGAG00000012672 transcript:ENSMGAT00000014256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE
EEELK
Download sequence
Identical sequences G1NJ66
ENSMGAP00000013352 ENSMGAP00000013352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]