SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013668 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013668
Domain Number 1 Region: 190-298
Classification Level Classification E-value
Superfamily PH domain-like 9.1e-38
Family Third domain of FERM 0.00000109
Further Details:      
 
Domain Number 2 Region: 67-189
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-33
Family Second domain of FERM 0.00000108
Further Details:      
 
Domain Number 3 Region: 1-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.16e-24
Family First domain of FERM 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013668   Gene: ENSMGAG00000012963   Transcript: ENSMGAT00000014580
Sequence length 328
Comment pep:novel chromosome:UMD2:3:96872750:96915614:1 gene:ENSMGAG00000012963 transcript:ENSMGAT00000014580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSSVREKFELAHPPEEWKYELR
IRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRG
NALEKKSNYEVLKRSFLLSFFISWRLLSFSKKAKTLRKLIQQTFRQFANLNREESILKFF
EILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQY
SNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQK
EGERALPSIPKLANNEKQGVRSHTVSVS
Download sequence
Identical sequences G1NJW7
ENSMGAP00000013668 ENSMGAP00000013668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]