SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013706 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013706
Domain Number 1 Region: 171-202,272-328,1159-1312
Classification Level Classification E-value
Superfamily ARM repeat 0.000000733
Family MIF4G domain-like 0.081
Further Details:      
 
Domain Number 2 Region: 629-749
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000785
Family Sec7 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013706   Gene: ENSMGAG00000012982   Transcript: ENSMGAT00000014621
Sequence length 2128
Comment pep:known_by_projection chromosome:UMD2:2:56148221:56207769:-1 gene:ENSMGAG00000012982 transcript:ENSMGAT00000014621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REKCLLPLQLALESKSMKLAQQALAGMQKLLSDERFVSVETDSDEKQLLNQMLNAVKVTP
SLNEDLQVEVMKVLLCITYTSTFELNGSSVLKIAEVCIETYVSSCHQRSINTAVRATLSQ
MLSDLTLQLRQKQENMTIENNEALQKFKSQGGTSAESLCDDVVSVLTVLCEKLQAVINDN
RQLQLLYLECILSMLNSSSPSMHQHKGFTDLIWKQLCPALVVILGNPIHDKTITSAHSSI
CLEADSPSSGVSDHGRGSGCSSTAPALSGPVARTIYYIAAELVRLVGTVESMKPVLQSLY
HRILLYPPPQHRVEAIKIMKEILGSPRRLCDLAGPCSSESESRKRSISKRKSHLDLLKLI
MDGMTEACIKGGIEACYASVSCVFALLGALDELSHGRGLSEEQVHLLLRRLEELKDGTET
SRDSMEINDADFRWQRRILSSENPAWESGNEKSPDISISVTTDTGQTTLEGDMGQTTPED
NLESQKNSLPSPAGHESKEIHYREPESETIDQPDVVQRSHNIVYPDITNFLSVDCKTRSY
GSRYSESNFSVDDQDLSRTEFDSCDQYSMAAEKDSGRSDVSDIGSDNCSLADEEQTPRDC
PGTRSLRTAALSLKLLKNQEADQHSAQLFIQSLEALLPRLIALPSIEEVDAALQNFSSAF
CSGMMHSPGFEGNPNFSFQTLMNADSLYMVSHYTLLLNLKLANSDYYRKKPPQAPVLLKE
FMKQVQSSGVLMIFSQAWVEELYHQVLERNMLGEAGYWGSPEEHSLPLITMLTDIDGLGS
STVGGQLMASASAQSPLSQNQKTDDSVVAGVAFARYLLIGCWKNLIDTLSTPLTGRMAGS
SKGLAFILGAEGAKEQNQKEKDSICLSLDGLRRAARLSCALGVAANCASALAQMAAASCV
QEEKEEKEIQEPSDAIAQVKQKVEQKLEQMGKVQGVCLHTAHVLCMDAVLNVGLEMGSHN
QDCWPHVFRVCEYISTLEHTHFSDGTSQPCLTITQSQQAPGGPHSDTELGEASQEQTPEQ
ETTLSSNPVIQPVSIQELVKESSKGRAFDFRGGSLLCGTSAAKAVLTLSTQADRLFEDAA
DKLNLMALAGFLYQLKKASQAQLFHSVTDTVDYSLAMPGEVKSTQDRRSALHLFRLGDAM
LRIVRSKSRPLLHLMRCWSLVAPHLVEAACHKERHVSRKAVSFIHDILTEVLTDWNEPSH
FHFNESLFRPFERIMQLELCDEDVQDQVVTSIGELVEMCSTQIQSGWRPLFSALETVHSG
NKSEVKEYLVGEYSMGKRQAPVFDVFEAFLNTDSIQVFANAATSYIMCLMKFVKGLGEVD
CKEMGDCVPGSGSASTDLCLPALDYLRRCSQLLAKIYKMPLKPIFLSGRLINMPRRVQEQ
SASSEDGIECILSDFDDDTGLINVWIILLEELTTAISNCPRQHQPPTLDLLFELLRDVAK
TPGPGFGIYAVVHLLLPTMSLWLHRSHGDHSYWDVASANFKHAIGLSCELVVEHIQNFIH
SDIGYENMINTMLKDLFKLLVACVAEPTEIISRVGCSCIRKKKKFNCFVCFRIYSFAHCC
VCHSCKICTIHIHKELVGCKYLKEVTQSFKVKYYCIKKVEIESRSPSYCSCFWNGRFSEP
EPLMIFLQQKTTFPQGAPVLVLCILFLSLPILGSPSIPFRTIVVSLLSHQVLLQNLYDIL
LEEFVKGPSNLEEKMTIQVPENKLAGFLRYISMQNLAVIFDLLLDSYRTAREFDTRPGLK
CLLKKVSGISGAANLYRQSAMSFNIYFHALICAILTNQENITAEQVKKILFEDDERSTDS
SQQCSSEDEDIFEETAQVSPPRGKEKRQWRARIPSLSVQPVSNADWGWLIKRLHKLCMEL
CNNYIQMHLDLENNTEEPPVFKGDPFFILPSFHSETSTPSTGGQSGKDTPSEDDRSQIRD
QLGDSLTPRSGEMLLLPPLSSPKPEKKEQNRKKEWWESAGNKIYTIATDKTISKFMTEYK
KRKQQQQAMTSFTKEVKVDKKGELLGSRGQDSPILQRPQHLIDQGQMRHSFSAGPEILRQ
EKRPRSGSTVSSLNISVRDAEAQIQAWTNMVLTVLNQIQALPDQTFTALQPAVFPCISQL
TCHVTDIRVRQAVREWLGRVGRVYDIII
Download sequence
Identical sequences G1NJZ7
ENSMGAP00000013706 ENSMGAP00000013706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]