SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015284 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015284
Domain Number 1 Region: 122-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 83-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015284   Gene: ENSMGAG00000014439   Transcript: ENSMGAT00000016233
Sequence length 304
Comment pep:novel chromosome:UMD2:1:96482614:96483525:-1 gene:ENSMGAG00000014439 transcript:ENSMGAT00000016233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAEIDPFLNLFASTDLQDLLAAESVGEEEQLENGDGSQRGSTEALRGDRREAEEVKLPCS
AISLVKRQERRVAAPRRAPRAERPTICSECGKGFSRSIHLIQHQRMHTGERPFLCGECGK
GFSQSSHLIQHRRVHTGQKPYTCAECGKSFSQSSNLLKHQRIHTGLKPYVCSECGKIFSD
SSTCIKHQRMHTGERPYKCSACGKSFSQHSHLLQHQQAHSGVRPYSCSQCGKRFGQSSDL
INHARTHTGEKPYKCSQCGRGFSGNSNLIKHTRIHTGEQPYRCSQCGASFRFQPQLVRHQ
KHHT
Download sequence
Identical sequences G1NNP6
ENSMGAP00000015284 ENSMGAP00000015284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]