SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015362 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015362
Domain Number 1 Region: 1242-1403
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-76
Family Pleckstrin-homology domain (PH domain) 0.0000000626
Further Details:      
 
Domain Number 2 Region: 1038-1245
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-52
Family DBL homology domain (DH-domain) 0.00000000765
Further Details:      
 
Domain Number 3 Region: 461-583
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 847-927
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000103
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015362   Gene: ENSMGAG00000014511   Transcript: ENSMGAT00000016317
Sequence length 1594
Comment pep:known_by_projection chromosome:UMD2:1:112342613:112422605:1 gene:ENSMGAG00000014511 transcript:ENSMGAT00000016317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVEHAFYGDKHASLGRKHTSRSLRLTNKASRRTRHASSGKIIHRNSEVSTRSS
STPSIPQSLAENGLEPFTQEANLEDFGSPIWVDRVDMGLRPVSYHTDSSVTPSMDSSTVL
TAASVQSMPDSEESRLYGEEPPFLAEGDGRLRRYAPNGTRFVETASFKKKRSKSADIWRE
DSLEFSLSDLSQEHLTSNEEILGLAEEKDVETARGTEAECSPQQLVGCQRANSMSDLYSP
KAPSATINGGPRNAFGGYCRNLVSGIPDIGSHKMASGAAEDAPSYSNYNTLPCRKSHCLS
EGATNPQMSHSNSMQGRRAKTTQDVNVGEGSEFTDSGIEGAATDTDLLSRRSNATNSSYS
PTASRAFIGSDSGSSSTGDGLRQGVYENFRRELEMSTTNSENMEEAGSALSDEQSSGTLS
SPGQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYE
TDGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTSSQTELENW
ITAIHSACATAVARQHHKEDTVKLLKTEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKK
TILDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFS
VSSFHALVAARTGESGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGE
GVDSVKKSLEGIFDDTVPDGKREKEVALSSVHQHNPDCDIWVHEYFTPSWFCLPNNQPAL
TVIRPGDTTRDVLEMICKTHQLDHSAHYLRLKFLIENQMQFYVPKQEEDIYELLYKEIEI
CQKITQHIQIEKSDTSSDIYGFSLSSVEEEGIRRLYVNGVKETGLAFKKGLKAGDEIVEI
NKKAAEDLDSALLKDVLIQPSLCLTVRTYPEIEEGQKLMQPPPRRLENPSDLSDSTLVFS
GSNQGHSLCGDPDSSVETAPEEAEVQDLASSDEADKMSKSTEQVAAFCRSLHEMNPSDSS
AHPQEFTGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTP
DELDVLFGNLTEMVAFQVEFLKTLEDGVRLVPDLEKLEKVEQFKKVLFSLGGSFLYYADR
FKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRRQHSSTLESYLIKPIQRILKYPL
LLKELFALTDVDSEEHYHLDVAIKTMNKVASHINEMQKIHEEYGAVFDQLIAEQTGEKKE
VADLSMGDLLLHNTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLGGSH
RASIYEDWDPFRFRHMIPLEALQVRALASADAETNSVCEIVHVKSESEGRPERTFHLCCS
SPEHRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMNRAVSA
PSKSLGRRRRRLARNRFTIDSDAVFTSSPEKEPQQPTHGGDTDRWVEEQFDLAQYEEQED
IKETDILSDDDEYCEAMRGAVADRDLRERLQAASITCRGDRSRPAMDTHASRMTQLKKQA
ALTGINGDVEGHGEEVIWVRREDFVPSRKLNTEL
Download sequence
Identical sequences G1NNV2
ENSMGAP00000015362 XP_010721116.1.16129 XP_010721121.1.16129 ENSMGAP00000015362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]