SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016520 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016520
Domain Number 1 Region: 371-735
Classification Level Classification E-value
Superfamily L domain-like 1.13e-50
Family Ngr ectodomain-like 0.0061
Further Details:      
 
Domain Number 2 Region: 801-946
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-42
Family Toll/Interleukin receptor TIR domain 0.0000195
Further Details:      
 
Domain Number 3 Region: 69-283,312-359
Classification Level Classification E-value
Superfamily L domain-like 1.36e-38
Family Ngr ectodomain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016520   Gene: ENSMGAG00000015581   Transcript: ENSMGAT00000017494
Sequence length 973
Comment pep:novel chromosome:UMD2:13:2672161:2675486:-1 gene:ENSMGAG00000015581 transcript:ENSMGAT00000017494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETAEKKARPSTGMCPSHCCPPQLLLLVTVTLMPMVHPYGFRNCIEDVRTSLCFRCIQR
FLESPALAVSDLPPNAISLNLSYNLMRCLQPSAFARLPRLHTLDLAYNQLETLSPGAFHG
LGALVVLDLSHNRLTTLAEGVFNSLGNLSLLWLQHNPLSTVSPGALLPLLNLRRLSLRGG
QLNGLGAVAVAVQGLAQLEQLDLCENNLTTLGPGPPLPASLHTLQLCNNSLGGLVGGSPE
MLWHVKILDLSYNNISQAEAFTQLHLRNISLLHLMGNPLDVFHLLDISDIQPRSLDFSGL
ELGTHGLKKVCLRLQGPRALQRLQLQRNGLKVLQRNALASCPVLQELDLSWNRLQQVGCA
GQLLDKKQQEELEVLTVEHNLLKKLPSCQGAQVLPQLHNISFRFNRILTVGSHAFAYAPA
LQVLQLNINSLVLLDRQALWGLHNLTELRLDNNLLTDLYNNSFTELHSLHTLNLRNNRVS
VLFPGVFQGLSELQTLDLGGNNLRHLAAQSLQGLSKLRRLYLDRNRLLEVNSRVFAPVQA
TLGVLDLRANNLQYISQWLHQPPPFRYLSSLYDLKLQAQQPYGLKMLPHHFFQGLVELQW
LSLSQNMLRAIPPDVFEDLGKLRSLTLADSSNGIHDLPDGIFRNLSNLQFLDLENVGLHS
LTLEVFGNLSQLQVLHLARNELKTFNASVASRLSSLRYVDLRKCPLSCTCDNTWLRGWLN
NSRVQVVYPYNYTCGSQRNAYIHSFDIRVCFLDLGLYLFAGTAPAVLLLLVVPLVYHRTY
WRLKYHWYLLRCWVNQRWRREEKHYLYDSFVSYNSADESWVLQKLVPELERGAFRLCLHH
RDFQPGRSIIDNIVDAVYNSRKTVCVMSRSYLRSEWCSLEVQLASYRLLDERRDILVLVL
LEDVGDAELSAYHRMRRVLLRRTYLRWPLDPTAQPLFWARLKRALRWGEGGEEEEEESSG
GGAGRPREGDKQV
Download sequence
Identical sequences G1NRB8
XP_010716136.1.16129 XP_019475305.1.16129 XP_019475306.1.16129 ENSMGAP00000016520 ENSMGAP00000016520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]