SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018319 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018319
Domain Number 1 Region: 644-798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-54
Family SPRY domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 32-105
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 345-421
Classification Level Classification E-value
Superfamily RING/U-box 9.5e-21
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 4 Region: 428-491
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.34e-17
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 5 Region: 109-167
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000305
Family B-box zinc-binding domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018319   Gene: ENSMGAG00000000636   Transcript: ENSMGAT00000020600
Sequence length 816
Comment pep:novel chromosome:UMD2:18:59516:80306:-1 gene:ENSMGAG00000000636 transcript:ENSMGAT00000020600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLGSGSAFGAGFPLSARRSEPSRKPMATQSPLDSLQSEASCSICLGYFQDPVSIPCGHNF
CRDCIARCWEGLEGNFPCPQCRKTTSHKNFRPSRELANIASIARQLNLRSSTWCKQHCEA
LKLFCKEDQEPICAQCDASQAHRSHTVLPAHQAAQEYKEEIQARLQASKEEREKYLESRK
TGGREKTKKEGKRIVCEFEQLQRFLKEKERFLLVQLADLDRAITKVQEDAVTKVLEEMSH
LDTLIWEMEGKFQQPDSKFLLPDVSIARTRYDFLTLISSPCLPDSTKFSKGSSSPDLKTK
WNTCWKTLEVHPQVWKSDLPAASGARREAVPFLMEERSSEGTPEEASRYSEGFQDEASCS
LCLGFFQDPVSIHCGHNFCRACITRCWEEEEETFPCPRCKATATQPNLRPNRELAKIIEI
AKRLSLRAPNAGERLCERHREVLKLFCEEDQAPICLVCRESQAHRLHAAVPIEEAVEEQK
EKIQAHMQILKEKKEKLQGLKEAEEGKSLEFLEKVQQERQKVVLDIKELQKFVEEQERLL
LGRLEKLDQEIVRRKEENLAKILEEISSISEQIRELEEKCQQPPCEFLQDSRNILSSLPG
WRMRNPRSVKKKIGLILHYPELGAGMSLGGENGEIMAVRLREKNLTLDPDTAHPRLVLSE
DQKCVRWEEARHPIPDNPKRFDSSRCILGCQGFNSGRHYWEVEVGDGEAWAVGVAKESVE
RKGRISVKPEVGIWAVGQCGAQYQALTSPTSPITLLSAPKVIGIYLDYEAGRVAFFDANN
EVPIFAYPPTSFASATFPSSHPHSFPFPPSFIPPKK
Download sequence
Identical sequences G3URL0
ENSMGAP00000018319 ENSMGAP00000018319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]