SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018657 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018657
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily E set domains 1.91e-38
Family ML domain 0.00000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018657   Gene: ENSMGAG00000012679   Transcript: ENSMGAT00000018909
Sequence length 122
Comment pep:known_by_projection chromosome:UMD2:5:39453459:39455931:1 gene:ENSMGAG00000012679 transcript:ENSMGAT00000018909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSKDGSIQEVNVSPCPRQPCQLVKGTSYSINVTFASKIESQGSKAKVYGEMLHVDIPFPI
PEPDGCKSGIQCPIQKGHSYSYLNKLPVKSEYPSIKLIVKWELVDDQDQMLFCWKIPVQI
TS
Download sequence
Identical sequences G3USI2
ENSMGAP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]