SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018774 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018774
Domain Number 1 Region: 488-792
Classification Level Classification E-value
Superfamily L domain-like 2.49e-47
Family Ngr ectodomain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 18-429
Classification Level Classification E-value
Superfamily L domain-like 3.32e-38
Family Ngr ectodomain-like 0.0031
Further Details:      
 
Domain Number 3 Region: 882-1036
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.76e-36
Family Toll/Interleukin receptor TIR domain 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018774   Gene: ENSMGAG00000014706   Transcript: ENSMGAT00000020832
Sequence length 1047
Comment pep:known_by_projection chromosome:UMD2:1:131533201:131539789:-1 gene:ENSMGAG00000014706 transcript:ENSMGAT00000020832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRHAKMSNALLIVLLFLFPMLLLGYWFPKTLPCDVEAFEGTVRVDCSDRHLTEVPRGIP
GNATNLTLTINHIPHISPASFIQLENLVEIDFRCNCVPVRLGPKDSVCTTPPSIENGSFA
ALTRLKSLYLDANQLSEIPQDLPATLRLLSLEANRIFSIKKNTFSGLRNIELLYLGQNCY
YRNPCNVSFGIEKTAFLNLKNLTVLSLKSNNLTFIPPNLSSTLKELYIYNNRIQEVQEHD
LSTLHNLEILDLSGNCPRCYNAPYPCTPCPNISIKIHSKAFYSLKKLRILRLHSNSLRSI
PSSWFKNIKNLKNLDLSQNFLIKEIGDAQFLKLIPSLVELDLSFNFELQMYSPSLNLSKT
FSSLSNLETLRIKGYVFKELREGNLDPLLSLRNLTVLDLGTNFIKIADLRVFKKFQALKI
IDLSLNKISPSSGESNFYGFCSDPRITVEQYSRQVSQEMHYFRYDEYGRSCKSKDKEADS
YQPSVNGDCMSYGKTLDLSRNNIFFVNSVDFQDLSFLKCLNLSGNAISQTLNGSEFYYLS
GLKYLDFSNNRIDLLYSTAFKELKFLEILDLSNNKHYFLAEGVSHVLSFMKNLAYLKKLM
MNENEISTSISMGMESQSLQTLEFRGNRLDIFWADGKTEYLSFFKNLTKLEQLDISSNML
SFLPPDVFSAMPPELKILNLTSNQLKTFNWGKLHLLTKLKTLDLSNNLLTTVPRKLSNCT
STLQELILRNNRIIRITKYFLRGAIKLSYLDLSSNKIQIIKKSSFPENIINNLRMLFLHN
NPFKCNCDAVWFVGWINQTHVTIPLLATDVTCAGPGAHKGRSLVFLDLNTCELDTSYLIM
YALSTSAVLSLITFAVMSHFYFWDVWYSYHYCTAKLKGYRRLPLPDACYDAFIAYDNTDL
AVNEWVMTELVEKLEDQKAKQFNLCLEERDWLPGQPVFDNLSQSIQLSKKTIFVLTNKYI
KSGTFKTTFYMAHQRLLDEKIDVIILIFLERVLQKSRYVRLRKRLCRSSVLEWPTNPRSQ
PYFWQCLKNAIAMNNTLAYNKLLQETV
Download sequence
Identical sequences G3USU2
ENSMGAP00000018774 XP_010724773.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]