SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019056 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019056
Domain Number 1 Region: 262-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-83
Family Protein kinases, catalytic subunit 0.000000000096
Further Details:      
 
Domain Number 2 Region: 149-293
Classification Level Classification E-value
Superfamily SH2 domain 7.26e-39
Family SH2 domain 0.00000146
Further Details:      
 
Domain Number 3 Region: 60-159
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-22
Family SH3-domain 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019056   Gene: ENSMGAG00000003468   Transcript: ENSMGAT00000018310
Sequence length 539
Comment pep:known_by_projection chromosome:UMD2:22:5317652:5324240:1 gene:ENSMGAG00000003468 transcript:ENSMGAT00000018310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVR
EGDWWLAHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLV
RESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFGSLQQLVAYYSKHA
DGLCHRLTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAI
KTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEM
GKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDN
EYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQ
VERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences G3UTK7
ENSMGAP00000019056 ENSMGAP00000019056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]