SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019087 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019087
Domain Number 1 Region: 76-162
Classification Level Classification E-value
Superfamily Virus ectodomain 1.39e-17
Family Virus ectodomain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019087   Gene: ENSMGAG00000016841   Transcript: ENSMGAT00000020612
Sequence length 271
Comment pep:novel chromosome:UMD2:6:20838568:20841479:1 gene:ENSMGAG00000016841 transcript:ENSMGAT00000020612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYFRGKILWFALPSNWGGTCALVQLAIPFTLAFEKGRSKRSLEACRVSFDDAIYIDSIGV
PRGPDEFKVRNLIAAGFESLISWVMINKYVDQINYIYYNIIQSAMKRIAEQLDATSRMAW
KNRIALDMMLVEKGCVCMMLGTCCCTSIPNNAALDGTITKALQGLTTLAGELAENSGIDT
YIIGWLESWFGKWKGVIVSTFASLIIAAGALTAIGCCIIPCVRGLIQRLIKTALLKQTPM
EPPYLDKMMILEEMENKESEEELNEWPSEWP
Download sequence
Identical sequences G5E7Q0
ENSMGAP00000019087 ENSMGAP00000019087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]