SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019093 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019093
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-49
Family Calponin-homology domain, CH-domain 0.00000032
Further Details:      
 
Domain Number 2 Region: 203-261
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.18e-20
Family EB1 dimerisation domain-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019093   Gene: ENSMGAG00000007478   Transcript: ENSMGAT00000020862
Sequence length 275
Comment pep:known_by_projection chromosome:UMD2:22:11210113:11218156:1 gene:ENSMGAG00000007478 transcript:ENSMGAT00000020862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLNVFHTVFWTSDNLSRHDMLAWINESLQLTLTKIEQLCSGAAYCQFMDMLFPGSVALK
KVKFQAKLEHEYIQNFKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANY
DGKEYDPVAARQGQETMAPNLVAPVVNKPKKPLGTGSAGRNEFKMISSLSPQRPIVAQRT
PATPKGSTGMVKKAAGDDESAGLIEQINVLKLTVEDLEKERDFYFGKLRNIELICQENEG
ENDPVLQRIVEILYATDEGFVIPDEGAPQEEQEEY
Download sequence
Identical sequences G5E7Q6
ENSMGAP00000019093 ENSMGAP00000019093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]