SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019266 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019266
Domain Number 1 Region: 375-555
Classification Level Classification E-value
Superfamily SPOC domain-like 2.16e-49
Family SPOC domain 0.00031
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.56e-31
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019266   Gene: ENSMGAG00000002238   Transcript: ENSMGAT00000002445
Sequence length 557
Comment pep:known_by_projection chromosome:UMD2:14:2293057:2294730:1 gene:ENSMGAG00000002238 transcript:ENSMGAT00000002445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVVGRNPIKIGYGKANPTTRLWVGGLGPSTSLAALAREFDRFGSIRTI
DYVKGDSFAYIQYESLDAAQAACAQMRGFPLGGPERRLRVDFAKAEETRYPQQYQPAPLP
VHYELLADGYSRHRSLEQDLRVRDRTPPHLLYSDRDRSFAEADWASPAKNAERRNNLESY
SRSVRSRSGERWASDSDRAMPKVWEERRKRRSLSSDRGRTTHSPYEDRSRTKASGPALDR
SPERVRKENHTTESGTEKEQSNSLQNNRHTTEEKPHREASDAPQPKKRDSERNHRTGESE
SKTHEEPKSETKKLKNLSEYAQTLQLAWNGLLVLKNSCFPTSMHILEGDLGVINGLLKDH
SSGGKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQSAPGSAGTEGSFPVVE
PGLQRRLLRNLVSYLKQKQAAGVISLPVGGAKGRDSTGMLYAFPPCEFSQQYLQSALRTL
GKLEEEHMVIVIVKDTA
Download sequence
Identical sequences G3UU22
ENSMGAP00000019266 ENSMGAP00000019266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]