SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019604 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019604
Domain Number 1 Region: 278-389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 2 Region: 460-566
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-19
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 104-219
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000864
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 4 Region: 572-637
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 632-697
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 218-280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000082
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 394-458
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000863
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 701-757
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000264
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019604   Gene: ENSMGAG00000012747   Transcript: ENSMGAT00000019490
Sequence length 855
Comment pep:known_by_projection chromosome:UMD2:3:91585520:91591029:1 gene:ENSMGAG00000012747 transcript:ENSMGAT00000019490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEDLLHEAFLKKDYLAQAPFPPGLVAFPTAPLTTPAGRSGPWGEPWGVAPGTDPSQPPTG
GSGSSSAAPSRAPTLGVTGVSGDEEGTTTTSTITTTTVTTLQGPAPCNRTLAGPEGWLVS
PEPASAPYDSSMDCTYTISVYPGYGVEIKVQNISLADGETLTVESAGGLEPAVLANESFL
LRGQVIRSPANMLTLRFQSPRPTSPGSYRFQYQAYLLSCPFPARPAFGDVSVSSLHPGGD
ARFRCNTGYQLQGAHLLTCRNATRPFWSAREPQCMAACGGAIRNATVGRVVSPGFPGNYS
NNLTCHWLLEAPAGHRLHLHFEKVSLAEDDDRLIIRNGNNVEAPPVYDSYEVEYLPIEGL
LSTGRHFFVELTTDSSGAAAGMALRYEAFEQGHCYEPFVKYGNFTTSDPRYPVGTTVEFS
CHPGYTLEQGSTIIECVDPSDPQWNETEPACRAVCSGELMDTAGVVLSPNWPEAYGKGQD
CIWGLHVEEDKRVMLDIRVLRLGAGDILTFYDGDDLTARILGQYTGARGRFKLFASSADV
TIQFQSDPGSGVFAYRQGFVIHFSEVPRNDTCPELPDIANGWKTASQPELLHGTVVTFHC
YPGFELAGADLLMCHWDLTWSGDLPSCERVTTCRDPGDAEHSRRVVSSPKFPVGSTVRFV
CDKGYVLAGAGLLTCHDRASGGPKWSDRLPKCIRRTSHATTPGVPAGGRQSPERRLYPAG
STLRFSCTAGRALLGEGNLRCLPGHPSRWSGSPPICKAASYDEFYSNRNLDAVAKAVPSG
TALEGTNVAIAIFLPVLVVALLIGGIYLYFSKLQGKPALQLPLSGSHPYDHITVESAFDN
PTYETGETREYEVSI
Download sequence
Identical sequences G3UUY3
ENSMGAP00000019604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]