SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML003213a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML003213a-PA
Domain Number 1 Region: 314-500,568-695
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000439
Family Rhodopsin-like 0.006
Further Details:      
 
Domain Number 2 Region: 99-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 245-278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML003213a-PA
Sequence length 706
Comment pep supercontig:GCA_000226015.1:ML0032:93787:95907:-1 gene:ML003213a transcript:ML003213a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRPIGLIEIESCFEMVLRLLDRQNDDCTVFESPRQEEKSCKFHFDTTHTYGLTDIDLP
AYINNKDLEWFCRLNDATSICNGVSECLTDECGCHDSQVDVFYCADGSGCIAWSGLCDDT
QDCLDGSDECFCFGHVVIPASEVGSKVCMSEHSFCLTKAYLGLGNMSEVMEMKYCEATIN
VPTRIKTPVERCLFEAFEEYRSLFEFFPYSRLHDYCRENCSYVSKFDDGWTKFCTNMGIG
LTDYDYYCDGGFTESYHISQLCDGQVDCSNHADEIGCPLPERFYCEPNLTSEWVSTEKVC
DNMKDCTNGADECGTCQFEVLSSSEFLIQSKIIIAVTSMMGILIIILNTKEGYRCWVTKC
SRKSKAIDRILLMQIFAYDALMGVYLLSIVIAALFLKFKGDYCILEKKWRASSFCATLGT
IFSFSSHGSLLAIASVSITRFITCQSIVADLKKRAVMVGCVIVTVMNFVHSVVPLIPITA
IKDVFRTGLYLTNISINPFFDKNPLNMTRLDDLYEGMLHRERTDTYKMIDDLKNATTKRE
IFDLFEISYYGNTGLCIHNIFKEQKLFRAYQVTYCIVLLVALIVVTTAYVKILLKQRETM
MAVNPNAANSNAQDSNSTTLTVKIALMIGSQLICWISFIFTVMYFQFFSSKPASPMVFEA
FALVVIPINSFLNPVFYSELYKKIKDLIREKWRQMINYLSPIEVPN
Download sequence
Identical sequences ML003213a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]