SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML003265a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML003265a-PA
Domain Number 1 Region: 913-965
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000135
Family G proteins 0.0042
Further Details:      
 
Domain Number 2 Region: 1409-1487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000101
Family G proteins 0.00049
Further Details:      
 
Domain Number 3 Region: 126-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 558-735,800-830
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000101
Family Rhodopsin-like 0.012
Further Details:      
 
Domain Number 5 Region: 955-1002
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 0.0000131
Family Transducin (alpha subunit), insertion domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML003265a-PA
Sequence length 1489
Comment pep supercontig:GCA_000226015.1:ML0032:581889:621953:1 gene:ML003265a transcript:ML003265a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEYQGDCYGTIFDTVYQACGHGGCAGYEVKGETTHFCSTYVCDMNDYIGVEAGQVSSQY
FDSNGHEDCKNTVADEQQDCREDEELYQCKDRYTGQSIPSWKLCDFSCDCYSCDDESFCN
GVQYGVMCNHSWGEYIPPVMICDGIKDCNDDSDETNCTTANFTCTLSPQHGLYNKFENGK
RNMGKDQICASPRKQLLCSDGLDQVNCTDSERVAMYCTLAGYPTSISIFAMCEGFPLCDD
NYNNKCVEPEGGCILHKTAVCDGIKDCPGGADETETSCGILSQKVKCVRRVVKKKAKGHK
VSYNVPLNWVFDGYVDCLNGEDENITYWQKCGSGSAVRYLDEGSTCIDQIKCPEDDIFIE
FKELCDKIENCGKESEVCRISRGTPNTWDMMIRVSGKSSLKGSPICVQGLKILQYQSGEC
HEVEMSNKMISHVYFTKTSTQLTLLMSKIDCRFIYGENYVYHAYTDSCLPTTPCPLKNIP
HDTCVNKVDKRVFAMTLSNDLTVVLKRSKKSEDRSGKVTEYHNELRTRVRTRSVSCTVRD
YHDECNDECDSSDKFILRNYFLKGLSWSVGSLATIFNGINIVSFTYDIRQVQTFGGLMNK
CFILLISFGDFLMGVYLILIAYVDLHFGNLYCQERYVWMSSIECSFLGILSTIATQLSLF
SMTALSIFRLRTVSKMIQRSVSLRSILDTILTILTILAISTALACVPVISVLEDFFVNGL
YYHENPLFTGSVSKTKHYDIFRGYHGYFKGTGLSWATIRLIVADMFTSEYGGVKGEDIHF
YGNNGVCVFKYLVTPDDPQKIYCLLVLAVNFLCFMVISGCYLLISIRAARSAGVFLESVP
HCPQTTGYTTANANSIQTPCSTGVTTTSRMAFDMSDPAEPIRFTKGMTGAMEKFCGCLMS
AEERAQKENSAAIDNELRKHKVEMDKELKLLLLGTGESGKSTFIKQMKIIHGQGFNQDDQ
VMYRKIIKKNIVSSMQNMVNAMELLYIRYEHETNATVNSKMIKSINTEDRDVDIEQAFTN
KIPSTNRGYKRIPVPIGEGRFPDYRRRRTAERAEKVDPVFRTRDQYNISQRSERVRSGAA
GELQSDIYMQLVLEELAAVLSAEIDPSLTEWKLIERGVEIIDFPLNQYILQIKSYRSNIH
HKGDPLYANNTIVDKSTSMLVHYMVNKRRIGQFVWNTIPYVAGTDVILFGCQAPYSRYQS
NPCNGEFEQIWSWNFTPKGATLTCFDEVQYEVDFQYARNPSCRNLGSLEIDQLRFTNMAG
FYYRAAPVGNKVPSEAPEDLKVETFATTMTTLPPTTTYGGWAVERPTCDCWTRECGSCKN
LECAVKYDLTASETGITVTSVLNRKDYNTIRLYNSDGKAIGYFQWNLKSMILEGCIFCRA
PRMPGIAKGDFNEWNFSMKDGVIRISIRFSRITDYFPQYTGDIHSALEARDFVLQMFRDS
SADTTTENQTPKPIYSHFTCATDTQNIKFVFNCVRDHILHTHLREFNLV
Download sequence
Identical sequences ML003265a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]