SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML00414a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML00414a-PA
Domain Number 1 Region: 699-849,920-1201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.37e-59
Family RNA helicase 0.073
Further Details:      
 
Domain Number 2 Region: 143-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000969
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 598-693
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000568
Family Rhodopsin-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML00414a-PA
Sequence length 1391
Comment pep supercontig:GCA_000226015.1:ML0041:10887:19077:-1 gene:ML00414a transcript:ML00414a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQGEARLTANIVLFFIVFNDANRSDVQIRVDIGCVTAIDQGKDQGQGIDHSCFRYARQS
FEDRLYKCMKKISDHTTLEQENLTCEFNYDAMFKERYLTLPESGLSVKDYLWSCKLSNSG
ERCNGISECLTDECGCGEYSTFDVFFCVDGSGCISWHKLCDNFQDCKDGSDECFCSGHLV
FFSPEVEQWGCFTEIHYCLNLKIMPDFNITPEVLKDVDCEKAYASETIPRNPIVLCFEDE
EVIEIYHSKFVNGPLELVAEYCQNNCSHIEGFNDGWIRYCQNIFSGISYYFFSFSCNTTN
MEEDYYIGQLCDGITNCKNGADEFGCPLPDRFHCDPNVSAEWVHIDKVCDLVKDCSNGAD
ECGTCQFGALSSSEFLIQSKLILAVTSIMGVLIIVLNLKEGYACFKTNCSSKIKAIDRIF
LLQIFLYDGLMGVYLCLIVIASIVLKMKGEYCLIEQDWRASPFCSSLGVIFSVSIHGSLS
AIAAVSITRFLTCHSILTEISRRAVIVLSIICACCNVLHSIMPVLPINSIQEIFRTAVFF
KNLNENPFLENSNPVNVSSINEFYNTIFNQEGKHDIYEMSKKLSNITTKGEIFDLTEISY
YGNTGLCVHNIFKDHGDHPIYRFYKILYCTVLLVLLISVIIAYIKIVLKQRSSARATNSN
FAEFNSAALTLKVTLMIGSQLACWIPLIIAIWYEGDVTEDTKIKFMTDGVLLRELQSDFL
LSKYCVVVIDEAHERSVNTDILIGMLSRVVPLRRKQNRPLKLIIMSATLRVTDFTQNSTL
FATPPPVVDVGARQHPVTVHHNKETREDYVREAYKKVCKLHRTLPPGDVLVFLTGVQEIN
RMIHLLRKTFPEKAADEGDKEAEKTEDISAKPVQLDKYDPYENKDDSPTEVIVQAAAPDQ
TDTKEQESSESEDEDIQPTPHDRSLPLLALPLYSALPPDQQQRVFNSQSDDYRLVVVATN
VAETSLTIPGITYVVDSGKVKTKEYCPVTGMSQFRVVWVSHASAEQRAGRAGRTGPGHCY
RLYSTAVMGNVMEKHTEPEISKKPIDGLVLQMKNLNIHRILNFPFPTPPSLSLIETAEKE
LQFLDLLKPGQTVNNTPVNKITDLGKQCVHLPVSPRFAKLLLLAVEQNVTQFALTLVAAL
SVGHLFTGPIPAPFKPRAGPARLLGDFMVILTAVGAWEHSGAGQPWSAAHHLRYRALIEI
RQLRRQLANILAQNHSVTLEPLLKPPTPGQITSLRRILTVCLGDHIGKLEEGTGSTDLYS
TEVVEENVQLHRESVLYGLHTEYVGFCSLEQESTGVKMRVVFGVEEEWLPTLLPNKCTFS
DPLDQPPPAYSNVSGEVMCHRTSTFGVRSWVLPAVNLPYPVGMKRFREFAAALLEGKGYR
YKGEAIKDVER
Download sequence
Identical sequences ML00414a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]