SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML004610a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML004610a-PA
Domain Number 1 Region: 1466-1633,1707-1832
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000101
Family Rhodopsin-like 0.0061
Further Details:      
 
Domain Number 2 Region: 1379-1415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML004610a-PA
Sequence length 1846
Comment pep supercontig:GCA_000226015.1:ML0046:42753:54527:-1 gene:ML004610a transcript:ML004610a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNVAIDEALKNVNQLERLGKRLTDEQPFIEAFPASVTYTVNLDTNFEDREAFVTGFSK
YLEEATVQSDLNLLLEEGEKHAVMLYTWRCISKAIPSVKDDSDPRRLEIYEKTIQVMERE
IGKLIEFYYFFDRAKDKFCQEITNLCHPQKIKDFISETHLVTLGQLINMFAVLDQLKDIK
ASISNDFTHYKRIDSLLGKQGMNEDRNMLYQQLTMFLAGRRVIMDSLFTKLSTIENYEEV
LAEIVNTAARRFEMKCYMTPKEKHMLLKVVAFGLFLIDGPANKSRGDKKGPSSRLLKMND
RSLSIQRFDRLFKTLPVVPLYGDMHINVYLCPRDQRFKSYELDPGKWTCVNKDVVKVSTT
QFNIVNKLQIMRQEYERITAELMNINGSYKNQYNISEGEGVTQNTSAPQFIEVFELAKRG
IQFLCECSATLMELYVWKLSNPRDKRELEVQLKNNLLNEETEGPIEEKDFDIAHYERATK
YNYTPEEKSAFVEVISIIKSTAALMKRMEVVFSEGIARCVHLEVQDFVQRRLRDLLRFSV
KRKKQIIRTVVTAIRETCADWINNKEDPNDPAIRGEKDPKTGHKVRIKNRACGLSSTQLY
MVRTMVESLISNKAANKKTMKKEMDTQHYTELDRFYTRSYFYKDLLNFGTVLSDCSDLPQ
FWYREFYLQLEDKIQFPIEMSMPWILTSHILEMVCKRVLKLSFQPNIYINSSSSLPVIEH
PLNKVRWMDDHDQHLPRETDFLLRSCCLPHNTHSLIVLFTLIARSEPVNEVMDARLLLVS
FALVILPFYQITARRADIDKEADEVVNAKNCSIVEVTNEGPIFLREKCGIYFKCPWSSVF
YTERSLILKFGLECNHRFSKICPNDERSYQVCGHLKPECIWRQQSEDMLCGDFICKYKHF
PENEKLDSGPRLTGWVNEVHAICNGKGDCNNTDLDETLCPTIDNKNEIFRCDGNSRIPIP
ESAKCDMKCDCPRCDDEAECNNVKYGIYCDTKSRSEGTYIHPMYVCDNVNHCKGGKDEKW
CGSQKSVRQCLPSSHFNRPNMKFRNVYPNQICAVPTGPPTLYVCSDGLDQINCTDSARVA
MSCEMGGYPTTLSDFALCRGYDLCSDGYNNLCSEPETGCVIHKNQLCNGKDDCKDGADER
SSECELMTVNSRCTRRVNPVLGRGNENVTSGGMAMPVSWVMDGHKDCVDGMDEEEDLWFK
CGDGDSARYRERGLNNSCQEVFLCPGGGFIEYKNLCKRQAFCGIESRICEKSKGVVDTPK
NVISNKSGTDKHLAYCLRGLGTLSFFIGSCEQSLFEGSSKDVLGVTKISIRHPSELDCSN
SFGELYVFQSCLGQCMNATCPLIPIKPSSCANIPSDQRIFSLTRDSQLTIVRRKNGLTNT
YFSDYFACKTGSCIPYSKVCDLSNDCGDWSDEKECSNHFSCNKGDMDEFVPLSSVCDGKF
DCADFSDECGELCDANKKKLLPATTMRSMAWIVGILAVIFNSISIIRFSRRVCQSSSYQC
RLDRILIMLVSLGDFFIGVYLLSVAIADLIYSDDYCEQRFLWLSSNYCSALGVLSTLGSQ
LSLFSMTALSLSRVSNISVLIPQDGTSLKAFCKIGAFSMTLLILSGLIAVVPLTPLHEDY
FVNGLYYENVTLFTGMVDINTHNKVLQIYYGRFKTRLQSWRFVRKMTSGMFSSDYSNVGV
RGDNVEFYGNDGVCLFKYLVTSSDPQRTFSLVVLVVNFLCFLFITACYCVINIKVRRQSN
RVAEHKTVKQRRVQRKLNAKISIIIFTDFICWIPFIFVSLLHYGDVIGATSWYPIFSIII
LPINSVINPLLYDDAVEQIIKRTVNKIPLLCERAKGYLNSYSETQL
Download sequence
Identical sequences ML004610a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]