SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML00643a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML00643a-PA
Domain Number 1 Region: 542-711,787-900
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.75e-16
Family Rhodopsin-like 0.0044
Further Details:      
 
Domain Number 2 Region: 462-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML00643a-PA
Sequence length 955
Comment pep supercontig:GCA_000226015.1:ML0064:4395:7262:-1 gene:ML00643a transcript:ML00643a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLYNCNGVENCENTEYDEAHCSEDSYKCFQQSFLDVPRERVCDGVCHCKSCDDEAICNG
YRYGMFYKDQFNQSRYLPPNRICNGRNEILDGSDELNCKETGRFCKTEIKDFSTFYGDSK
VRTGFRPLRNDSVCSVPNADEDASDGDCVDGFDQINCTDKTIAPLRCKINGSESTVSKYV
ICKGRSLHLCDGGLDSACVFPEGECRVHKHQVCDGVPDCPEGGDEAHRLCRGLTNVFCTR
RFSNTNTRLKILLEWVGDGVEDCDDGIDELEEQWKTCGQGMTARFIMNNESCKEVLLCPD
EQKFITQKELCDQQETCSGESYICNAARMGGFKLGTKFQRKPTHPFCLKGMENFLTLKGY
NQTLQAPCQEKLLTTPEIAFGVKEKLIVQPSRYKTNCRYVFGESYVYHSCSGHCSEETAS
CVLTRSLKHNSCYNKKNRLYTLSGEKNLTIAFKGKNQGEYDNSVFSCTNGNCIDYDKVCN
LQNDCGDHSDESECINHFKCNGTDGISEYIPLWRVCDGNLDCVDFTDECNPTCIGNKKII
DGTFLSVFSWVIGILASVFNIGTLFSISCQFNRTSSNVRTINLILIVIIIVGDLLIGLYL
IGISVASTTYGDNYCIKRFDWLTSTSCQLLGVVSTIGGQLSLFAMTILSMVRMVCVKSTV
PNYTFNRTAILVGGMSAGSIFLLPLFISVIPLISNFEDFFVNGWVYLDSMLFIGAPNKQK
YISIISAYYHDKIKKPKLYQFSWQRIIHLISDIFSKDHTGLKQKPLNFYGNHGTCLFKYF
VTPNDPQSLFTWTLLGVNLCCFLIISYCYIWISWKSMSSSSKFNSSTSKKQASKQRVLQQ
KIALMVITDFLCWVPFTVASILHYSGTIDATEWYPYFSSVILPLNSVINPLLYDSNISSI
ISKLFRRESSPTSNNTAKMKVTIRDSYRRSSFKMVDRGIEHQDSSAKAETTLNTV
Download sequence
Identical sequences ML00643a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]