SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML008322a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML008322a-PA
Domain Number 1 Region: 3-206
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-21
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML008322a-PA
Sequence length 234
Comment pep supercontig:GCA_000226015.1:ML0083:163028:165460:-1 gene:ML008322a transcript:ML008322a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSYSNCPCMVALTIDRLVAIVRPFRHRTLFTTKFCIALCVAVWLPQVVFYCWFAISMT
TTNSAAFSMEYYANYHRCQNSYKHPWLRTARFASLVWAPFTAIALMYIVIFFKVAKSGAK
SRNLLAISTAVIISGVICWFPSIISSIFSIPMNYKIAQVFTVTLFYINSSTDPLIFVLLM
PAVKKYLVTRLIHCQDPKTQVSTTSSTLRYVSTCRNSCTTSPGKTMRISVTSKV
Download sequence
Identical sequences ML008322a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]