SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML00857a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML00857a-PA
Domain Number 1 Region: 183-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 103-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000123
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 148-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML00857a-PA
Sequence length 569
Comment pep supercontig:GCA_000226015.1:ML0085:46501:51297:1 gene:ML00857a transcript:ML00857a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNAILVCTLLLLSISLTIAEDTTTPFTKVTEKPVTWKSEKRWTEKITAAPVRCPAGYY
LEGTSTCKQCGRNTYSEEGSSSCTSCPEGLVAPAGSQSSDACEEATCPGNKEACPEGSGC
FDIWQRCDGKPNCPDGSDEAVELCEGEYCPEGTERCPDDSRCCGAKSFCDGTRNCDDGSD
EDPLFCGEYTCPGGMSKCGGGLKCIDNWRFCDGSQDCKDNSDEDPDFCAGYECLGKRTKC
GDGLQCVLMQRVCEGKSVCKDNSLTPDEEFCQGDEFSVNNQGSINSGSSSSSGTSGGWSK
FCKAGQHKVGKKCEVCPENTYSLAKATSCTPCPDDKISPAGSKSEKACDYDPCSAGDYMT
ESGCQQCGENTYSGAGASSCTSCPDGKMSAAGSTSEADCQHEQFPTCNCWTPACGYCSNM
ECTVQQNLPNNQQGFEVEVTTSVTWRKTNTIFLYDANGHVISRLKWNLETIDLTGCGGCK
TPTELRELSKGADTVSWTFSLKDGLFQISSGGEVFYERQLPKECASIYENIDRFSFSDST
CEGSYSFRSNEMERGAKMDSDCGGVCPQA
Download sequence
Identical sequences ML00857a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]