SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML012714a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML012714a-PA
Domain Number 1 Region: 32-248
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.43e-39
Family UbiE/COQ5-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML012714a-PA
Sequence length 373
Comment pep supercontig:GCA_000226015.1:ML0127:133135:134256:-1 gene:ML012714a transcript:ML012714a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKSSILESVKEYYGKVLESSSDLKTGNEVCNKNLSADNKYICRAISEVHQAVSAKYYG
CGLCIPPALQRANILDLGSGSGRDCFAVSKLVGPAGNVVGIDMTKEQVDVANTYIEYHTE
RFGFKQPNVKFVEGYCEDLIGAGLEKDSFDVIISNCVINLCPDKETVLREAFNVLKPGGE
LYFSDMYTDTLQSDIVREDKVLWGEGFAGSLHWKQFHDITKKIGFSAPCIVSCSPIRVDR
EDFKKKLGEAKYCSVTYRLFKPNVNQANDVKIFAQSGVGFVTYRGQILHHEDSFKFDHRL
TLQKGARTAVPAQVMSMLLSSRFSEEFDFEAAGTDDKACCRYTWIDLEDPFDVLKRMAEK
DGQLTFCQKIKGT
Download sequence
Identical sequences ML012714a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]