SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML01806a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML01806a-PA
Domain Number 1 Region: 649-797
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000888
Family Rhodopsin-like 0.0069
Further Details:      
 
Domain Number 2 Region: 569-605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 606-639
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 183-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000111
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML01806a-PA
Sequence length 851
Comment pep supercontig:GCA_000226015.1:ML0180:18728:22485:-1 gene:ML01806a transcript:ML01806a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLLNLVVTTATLFAVFAVSEDDFFSCEIAESNGFLKNVCQKRNSNKTWYKCITTDEFY
YHPGNLSYFHGDLCSDDPHFYQACDENANGKITNSELLCGNYLCELQNPKGQLIIATTKE
LSAFGTCSKNCRNTELNRVGCSEENIVLPSGEQVGSTERCNDVCDVWSCEDEALCNGFSY
GIYCKREETNAYIPPTQICDGKKHCPNGEDEANCTKTKDVESLCRHVASGNLVPVHNYTR
CTKVDRSAFSEPLNRLKYCELADVALHQTNCSDPSKVGMTCTVNGYKSSISKYLICFDDS
VGTCDDNIDTKCFTTQSCKVHKHLLCDDKVDCDDRADEVHPICSAKTNATCSRRVGSKTE
LPIPISWLKDGVVDCENGADELEDWPTCGQGGTTRYISDNGLECENVFICRTGSPGFVEL
NSLCDGLESCGNENMVCSGSSRTETLSTTVLTTNMGLTKILSFCVAGLNNFQQLVDICVT
EKFNFPDKNIFGVDTKTSVILPIDTNTCDHMFGELYLYTSCLGRCMGSICPLRNLPRYEV
CPDQFPKRIGTVVNNEYLIFFTKSHGTVYNNKYFVCDEKLKCVDYAKVCDLVYDCKDGSD
EVRCTNHFKCRSTGKLIPKTSKCNGHIDCPDLSDECNEQCSAKILEGAFLKGLSWLIGIL
AIFANLVMVGNSFWTLRRCRTTAAVFNRLFISIIAIGDFFVGCYLFTIATYDSFIYGKSY
CQRQIFWIASFECSAIGVFSTIGSQLSLFSMTGLSIVRIHGIMNSMRIPGEITAIGIVKI
VLAMVSLVLFSSAIAVAPVIRKFEDFFVNGVKFSDGLRIFIGVPGKRTVFKVMEKSIMEN
SNSISKEYVFT
Download sequence
Identical sequences ML01806a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]