SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML019110a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML019110a-PA
Domain Number 1 Region: 888-1057,1129-1241
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.15e-21
Family Rhodopsin-like 0.0086
Further Details:      
 
Domain Number 2 Region: 808-842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 175-264
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000471
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 
Domain Number 4 Region: 842-876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000445
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML019110a-PA
Sequence length 1389
Comment pep supercontig:GCA_000226015.1:ML0191:59886:64602:1 gene:ML019110a transcript:ML019110a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSNLSIDISSTFFLKTMFTGSYGKDCRMVFEIRDTDVMYHLDFRLNIVPEGYRELIQAS
KWDGLWGYKIPEMRSPLPDMALENDVIVLVTDKYFEVTINNIMITPKFGTDLERLYNYKG
IALHIFGECVWVDLKKSYMTNGGGFVFSLMNENNSKIDLGQSSGLLVAKRAGFSRSGTVC
GKKFNDKSTTILCQELGFRGADAWRTGLLWNIQESYEVALSEVLCSVNAESFSECVYSTN
IDLSTNASTCGHDSDVYLSCTSNNDLCNIQKHNGFLKYVCYDYNGLQYFKCLNSDVYYEV
EAALPGYSKFSALCKNDPHFYQTCGAGHNEAFGDKDGALCGYYICQDDNGVFTSSYTAET
SYSCDDKKQCSNTDMDESDCSYNFVKVIFDSVGGLTLPSSKVCDNYCDTEECMDESICGN
AIYGLFCDGLQYYPPYLIGYYENWPECAFDGSHNAEITCQHYLHNYEVPLYDFNRCATFK
FVKSVIDETSRLTDEYQPYCKGFIDQTNCTDSDRVAMTCYVNGYPATISKNILCHGLQDL
SLCSDGIENVCLSLSPTCNIHKHQMCDNVIDCTDKSDENDLICTQLTPTACPRRLGGREL
ATPLAWLGDGVIDCMDGEDEEHVWPTCGEDVTFRYVTDNTSCTDDFLCLHGNADYIGMTQ
LCDGIETCGNENEICRLSRDIPTVFTEAYAPKSGVKNLMHCQKGLLNLQYISSNCTTVMF
SYPRGEVFGLSQRTALLIPTEAKECDNLFGELYVFYSCEGRCSNSEVTCPIQTNFLRDDS
CPGQFSDRAYTVINNQDLTFLFKTGGSYSIDLFVCGNNRCIPFYKVCDLVDDCGDGSDEK
GCSNHFRCASNTSYISTSQKCDGNIDCLDLSDECNAQCGKRIIQGAFLQGMSWTIGILAV
VFNCIIIFQNVLSLKKCSTALLLLNKLLIMLISVGDLLVGCYLVIISFVDSRRGNDYCSS
QQEWLTGPSCSLLGIFSTIGSQFSLFSMTALSTARLFGIKNSMRIGSGLTKFGFLKSVSV
ILMIVAISTAVALIPLHPSMEDFFVNGISYESGNPLFTGFPDKRKHLKVLEAYYGRMKKQ
SIKWKLIVDMIKGMFTDVYGGIKFKNVDFYGNDAVCLFKYFVEADDPQKLYVWAVLIINF
LCFTIISFSYIVISFISTKSSKSLGKQMRNSAVEKRNRQMNKKISIIILTDFCCWVPFIL
TCALHTFAVLDATEWYALFSIVVIPINSVINPLLYDTTISKLLRNVTTKTKAVVSQTSLA
QRSVLSKTNQASSLRPHSKATKPPSPAVYTELKAIRTSKGVKVSSGVNHDESDYRYDTNT
PPRVKQLEIPHACTIHSDDIVESVDYGENQQQKQGSNSGANDNSAIRLPNATSLRDSTLN
NDNLAETSF
Download sequence
Identical sequences ML019110a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]