SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML026412a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML026412a-PA
Domain Number 1 Region: 1992-2171,2259-2378
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.79e-16
Family Rhodopsin-like 0.0047
Further Details:      
 
Domain Number 2 Region: 256-443
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000966
Family Sphingomyelin phosphodiesterase-like 0.055
Further Details:      
 
Domain Number 3 Region: 712-974
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000133
Family Reverse transcriptase 0.045
Further Details:      
 
Domain Number 4 Region: 1910-1945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 5 Region: 1003-1079
Classification Level Classification E-value
Superfamily SRCR-like 0.000000798
Family Scavenger receptor cysteine-rich (SRCR) domain 0.036
Further Details:      
 
Domain Number 6 Region: 1109-1186
Classification Level Classification E-value
Superfamily SRCR-like 0.0000275
Family Scavenger receptor cysteine-rich (SRCR) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML026412a-PA
Sequence length 2410
Comment pep supercontig:GCA_000226015.1:ML0264:87589:99752:1 gene:ML026412a transcript:ML026412a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIMHYAHGVLAKRLLDDEPLFKLHTRYSLLLFARLSFDFDRYRNFLLFTMPNTYPPSQN
HSGGGTWKKRPPNKTQKLFFPAKYFCDLHVHCRSSSDLQLFRNFLETWNVTPHSDVYKST
TSSVYKGQAENYRLLILFLSAKCFSDLRMHCRSNSDSMLVRKSLETWNFHLPRSSTQSDT
SGYKSTSRPAAVQSGTGGDLSRLSSDCLNSEPLPVTNNEPKLKNVTIDGSFRYEESNTKR
PKAEVYYSMETKGEIFIPDYQCFNSLRKGTRSGGLCIGIHRSISKQIKTLKTESPDIQAV
KIKLGQAPDFKELTIVNVYDSPEHSSFKNRMRLNNGSPSVTTLDTLLDFSMKNLDQDNLI
YLSGDFNARTASLNFEPTSRLAVTRNSTMQGIVTLVKLSEAARTKFSVVDYVAANQNLRN
LASSFKVLDLTKHSDHKPCVTTLVIKHNFIASDAILESLQSAPSKYKWPNEDGMDTRFSI
AMNNTLVSEKATKLAGKSCCSKEEVIQMNTDIVDLYRDVADTVIPRKLPSTTNRNRLKRG
NRMKPKNSWFDITCIRAKRDLNMLALNYGRSPQSEHLREAYYNGRRAYKKLIKTKKEDFI
EKLCRDIENNHSVKWETLKALKKQHCSNINLDAFDMINFCKFFQNLYGKSTIEAEKIYSL
KSEMAGKSTQEELSSILDEKITLDELTSCIKAAKKGKAVSEDLIPNEFLKASTKTMLNAI
LNLFNQCMIVGVYPWTTSIVTPLHKKGSVYDPNNYRAIAVASYLGKTFASILLKRLIAFR
NSNEPDTQNQLGFCKGAQTSDHIFTLTTCIEKYVTRSRKRIYSCFVDYAKAFDSVCREAL
LFKLWKMGIQGRFFKCIEYMYQNSSTKVKLLNKLSDKIDVICGTEQGHPMSPELFKCFIH
QLSKVINCIEEINVPLLGAVKVTHLLWADDLVLLALDRESLQAMLNVLQSYSLEWGLSVN
VSKTAIMVFNPTDKDIKSLVRLVDPKDEDTNVEKSGLLLYNNKTMCSEGFTIDLSRAICR
LLGFSDSSKWTAVKYEGRYEMSTDSLECNILGGDAACILHDFHYLDCRSGSAVFLFCTDK
HVPLFSLVDDAGNVVRDQQLRLLLYRGIPVHNSFFDDTTADAICRQMNFSSALEWRTGSE
YDIQDRYQSGITIRCSVADWEPKKCIIGENSWAEDDGEDVFLSCTDTKSLCGAGSYMSMG
RCELCPRHTYSNNTNHNTKCFRCPEMKGYSEKGATSIANCTEDITWRFDGKCGYNRPGVR
EYYECDPDGESCCRNNECVSSENFNHCFCSGCIEYSLVRDIRNSKENCIISNLNGYLKYV
CFDEYEHLLFYKCPFDNKKYEAWYENRYQINNQIAVTSVCDEDVHSYQACGFDTKITNTD
VLCGGYFCHQFVTVEGQKLHQLHPCEKDCQVEVRKYFCRTNMFTEITTSITSTIMTATVT
IGRPSAYNERFIRERGIFCDDKCDYSYCDDEALCNGYRYGLLCPYDTFLQWKESDHDFVP
VSEVCDGLKTDLCQGLMNGEDEENCTSYSDSDTSDKCVRYVRKKLRNEKDAIVRIFNYTR
CSLFDEKAKNTDLRNDPYCADYRDQTNCTDVQRVGGYCLINGYRSSVSKYVMCDADRKVM
KENDKHGLCHDDLENQCYFPSVSTIKCKVHKHKMCNGVVDCIDRSDEYDAVCSYTVRRFS
CERWFFPNMSIDFPYMWVKDGIRDCVEGEDENDEEWLVCEYQNQTYLGTSKREKRQNEDC
KNVFKCPSGIRFVEEEELCDGVESCDTDMNIENNICRIARDFPSKLTAITDGRSYGLNFC
ESLIKSDTPVTCSLRKLEGTWMETRVFGALSQQSADMYLPATKVECANLFGEYYAYYSCM
GLCLEPEAICPLPQRPLLHDACRGQILDRVYTVANRSYLTFVRKEGLDYYHENYFQCKNG
KCVVHSEVCDLIDNCGDLSDEEDCANHVVCEDTLNTTYKHLISKRQKCDGIYDCIDLSDE
CNESCGREILPSWYLKISCWTLGILAILFNLFSLAKGIINIKDSHTSIMLFTYCLIYVVT
FGDFCIGLYLVILSVYDSLIFGKNFCKEQAVWLTGNTCSYLGQISTVGSQMSVFSMTVLS
VNRARGLIRNDIASPSVLNKMDVLKTTFTVMILIFTSAAVAVVPLLPVFEEYFVQGMYYD
PKYKVFIGFPNKARHINVLKEYFNNTVDSQSIRVNMTWKEIGKKVDKMFTDDYGKLDRTA
VHFYGNDGVCLYKYFVRTDDARRSRQVLDGVTDITENKGYPIVWFMLALNLFCFVCVAIS
YVMIYFTTKKSSEQSNSRQNPAVERKSREFELRVTIIIATDFFSWVPFIIISVLHNIKLI
DASSWYITLTTILLPLNSVLNPLIYNNDIRNIIFTHISKLISLFAKRNKVLSSQQHPNGQ
VIEAIELELM
Download sequence
Identical sequences ML026412a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]