SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML02806a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML02806a-PA
Domain Number 1 Region: 230-521
Classification Level Classification E-value
Superfamily ARM repeat 3.84e-28
Family Armadillo repeat 0.02
Further Details:      
 
Domain Number 2 Region: 534-741
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.6e-26
Family Glycine N-methyltransferase 0.00028
Further Details:      
 
Domain Number 3 Region: 5-37
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000806
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML02806a-PA
Sequence length 833
Comment pep supercontig:GCA_000226015.1:ML0280:69567:82536:-1 gene:ML02806a transcript:ML02806a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGSHQFRLKFKNQYLKDSATIEDYGIVDSHVINMIPLSNKSLTDHPLISSASSLQSRE
NEDTLQRMLFKEVNTLKRREKLCNDLQVWIWVLFVFGFITFLTEYWFTAFYKCVFALLAL
YVCPKYTRLSGFYLRVNERDDLRILAISFCALALFAVNLGLLASLESNVCRYITTLPAFP
CSEIVYFSFALYVFESVGFFGFFVLSTLLWANFKFQIGNFIEPVLVEIRDIKYIFAAAKS
KSVKEQRSAGLDLANLAASNVDNKFALVAEGGLQVLIDLALSEDEGVRGYAIEAISELLT
IKSIQNEFVEIGGVNTLMFALHSTDTHIVKESLLAICQLCQDNEDVMVHVLGENGMDDLC
HVINTCKMECVRLVAGIFLDVSFSDNLRGELLKHRKYVPVFERMIRCSDHITQQLCLQTL
EMIALTSPGSITSHPNFIAPLLSSIISKATDLQVRTISAKLLLYFVDNTETMQEVVNCSV
DIREVLVTLVTTQDNVMQCVAAKILYLLVEHDRKIKHTIMSVGDEDQPSLNGENTKKVVN
YDKEEDRPYFNGKEAQMWHLYVGDPTTRLSNYKDSLLKLLRDRSARTVYDVACGLGIDSC
MLVEEGFKVVTTDVDKDFLNKAREMKAKLPELGQDWQIGYGDWLDLSSASVKHPDEGYDV
ILCIGNSFATLPDFEGEYRTHMRALENYKKLLKVGGMLIVDHYNYDYLLENKTFPPYKNK
NIFYTTDRIFNTQVEWVEKGGKVTSLIFRSDVDVSETDLETDPDVQMKERNGRKVPTLRR
NDIPFCPFTCSEFAGILKTVFGEGAEYHVLPDFKQDDFDDYLPNYWVHCIVKS
Download sequence
Identical sequences ML02806a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]