SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML030910a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML030910a-PA
Domain Number 1 Region: 765-948,1033-1138
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.65e-17
Family Rhodopsin-like 0.0045
Further Details:      
 
Domain Number 2 Region: 686-718
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 283-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML030910a-PA
Sequence length 1149
Comment pep supercontig:GCA_000226015.1:ML0309:122136:125582:-1 gene:ML030910a transcript:ML030910a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKWRDDGKCGSFYLLEDGSPAQCDPEGETPCCSNTKGFGECGTGMWHCSCLLCEDYKFLK
DWEKSGGTLKWRNDGLCGAGNYLPDGTLAECDPDGDKACCFKDEPNNSERRCVALGPLDC
TCRACVDYRMVKRVRQTRTDGNCALLKLDSGFLKNVCFDESLKRLNYRCINSDMNYKPLY
TDAVLAELGGVSNICENDSHAYQACGFMRTPITNTEVLCGGYICDQLGTIPGKYIECTGD
SCRTENRDCNTSRDKPDTTLCNDRCEEDACEDESYCNGYKYGVTCTTNSFYTAGDSYQLP
VEFVCDGSVFCDGGLDEQNCVVTNSSLNTCVHWNYGITEAFLVPILNYTRCSVIDVGNIK
SPAYPYCKDYSDQTNCSDPMRIGGYCSINGFVSSVSKFVVCYKYDQALMKLCDDNLQSNC
VLTFTNCTVHKHKMCDKTKDCYDGSDETDDMCKTLTGETEFTCIRRFNPNKGYISTPVSW
IMDGTVDCMKGGDENSTLWKVCPGEFRKVILPGDTCQDSYRCPGGDRTNVLFANLCDGVE
SCGNGAENDVCRIARDFPVIQNTPPYKGSIRDVCSTVKEDKSVTCTVKGFNKPWGTSTDV
FGVNTEKRLIYPTSKTRCGHLFGENYMFLSCMDLCLEADIVCPLDSNNNVLSYDSCPGQY
PNRAYTIVNNSFLTLVESNNGSYHQEIYQCNNSRCVEYRQVCDLVDDCGDMSDEINCKNH
MICEGSLSLAKHQFISLSQKCDGIYDCFDLSDECNDSCGKEILETWRLMVTCWVMGTLAT
LLNLSAIFRGFSTFKHCETKSMMSSKALMTLISFGDLLIGIYLLVLSVYDYIIFGKDFCK
SQAEWLTGPECLLLGVISTVGSQISLFTMTILSFMRMKGLTQISVHAPVNKTFILEIIAQ
VFAIFMASLAIAVAPLVPVLEDYFVQGMYYNHTYGVFIGFPNKDKHIKVLRSYYGHNITD
RAANISTTMSWKEISEKVDGMFSQDFGRLSRSPVHFYGNDGVCLFKYFVRTDDARRSRQS
HQAGVGITNFNGDPIVWAILVLNLSCFIIITCCYIVIAYKNKISSRRSGQHDNRDRQRNE
RTIHNMITVIIATDFLCWVPFIVICALHNLAYIDASTWYASFAMTVLPLNSVINPLVYDR
IIVMAVMQT
Download sequence
Identical sequences ML030910a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]