SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML03238a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML03238a-PA
Domain Number 1 Region: 717-892,956-1079
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-18
Family Rhodopsin-like 0.0062
Further Details:      
 
Domain Number 2 Region: 637-672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 674-704
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000707
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 4 Region: 416-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML03238a-PA
Sequence length 1116
Comment pep supercontig:GCA_000226015.1:ML0323:49779:53858:-1 gene:ML03238a transcript:ML03238a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKDFHVCPSYGLHVHIHNDTLASLICQKLEKGNIGIAQDLPVEQNIGLLQWIHITNPEN
YTTDFGSVVNDSCSGLNRSLAISCTDTKDVVFQGIVEGNFIRTSATFKDVTIYKCEEQDE
IYRISLERTDYCYFTHICSDKIAMRYQSCGCAGVHVNDMVCKGMVCLQRDNMSKSYKNIP
TRRICDGYYHCSDKSDENNCDYSEKRGRNCTPNSEVHNGFVPKLYECDSYSDCKYGEDEY
HCGFSFGISCTRNNHAKDVWVDRKHICDGEPYCEYSEDEDPNLCQNKHNTKLTCKEKGSD
LTKAIKEINTCYYPRSYSTTTSNNDFLGCEGLLDQMNCTDTNVIHCTVQNHPNTRVRDRW
LCNNWQVCDDGMDELCLTLSETCTVHKYMLCDNKIDCSEHAEDEQGCETVLEKNISCERH
LTREERKTLSIPSKWLCDGVQDCKNGEDEDDVMFHCKKGIECPDIAGVYIKKEEFCDNVE
SCAGSEAELCAVTRLSEREYEEGSTYKDVKDDILVFASDVMADNLIAQQFQFPCLPGIMK
ENSQHMKSSCFKRELIKINPGRRNKVHHFWWNECKSLNTSSLVRYGLKELFCNSYERSLR
LQSMEETECIAIQPIYELSTVQGQKLAKYMKVENNTLAEKVFTCKNKKCLESNLLCNFID
DCGDGSDEDNCPFSFYCKKGFPRTVSHTKICDGIFDCSDGSDECSQGCGNDKLLQSSALR
YLALLIGMASLSMNTYSVFHCSSMFFKAQSKTLRVNHFFMSLIGLGDLTLGVYLVIIVSF
DIYYDNSYCKSKYEWLTSKTCSFLGILSTFGSTLSVYTMVFVSLYRAMKIEGGNVAADKE
VLASVFTGIVLVLGVMMIAALPVTTLFQDYFSNGMWYKENPIFPTLSDMNSHIRFIAKYN
AIKNDTSQVEETWSGLMDFVRKLYHNDEAPSGIHQTFYGNDAVCLFKYFVKSSDPQYSFS
MMMTVMNCTCFLLITFCYAFVVYKMKRDTDVQGMIKDKTREANTKTIQIKIAVITLTDLA
TWMPFCILAWAYTNGADIPKEKIYQIAAIILLPMNSIMNPIIYNEFPTKFREAIQKLTTT
SQWHTNTSNRVELSQGVAQVQSRTQLERCKIRDVSK
Download sequence
Identical sequences ML03238a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]