SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML03596a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML03596a-PA
Domain Number 1 Region: 843-961
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000128
Family Rhodopsin-like 0.004
Further Details:      
 
Domain Number 2 Region: 534-569
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 569-603
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000471
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML03596a-PA
Sequence length 1021
Comment pep supercontig:GCA_000226015.1:ML0359:42841:45906:1 gene:ML03596a transcript:ML03596a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFGTEVAACGYLICQWDLPEFEINMPYNYDKEEYYKPTSLRFGVTISSESELDCELNLD
EHCLNSINGTPVLKYACDGWFKKKVEKLRPEWNNYGHLLRHVRENELCNGFCDSHSCDDE
AFCNNMTIGIFCRSLHWGGIVQYVSPRQLCDGNRNCQFNTDEENCESFTETCETTNVYLM
QSIGHLSNSVRRFLSPRSKCSVPALISALKVCIDYKDQMNCTGSTISPLVCNVDGYPTTI
SEHVICKGTGFSLCDDKIDNECVEAETECTIHKHKLCDGIKDCRMSSDEENSICKDTFSI
PTTHCVRKLSRDSLKRELPNRWVLDGVSDCRSNEDENPEYWTKLCGFGLLEFHVPNSEEG
ENCSKVTQLKCPLSSKLLNIERVCSGNSVDNCDSEVCQTARKEFRAYINDKLPYQRSKSG
AKRTVYCLSGLHGLEIQAGNCSEIEFRRKVLGVPNIYILSSQAFAKSYIKCSEIFGELYV
YLACSGLCGRSVDKFCPLRSSVLTSTCTNYPANKTVLSLGDDGKLVHAIVTGNTFSHEIF
SCDNGRCTTFDKVCNLVDDCGDLSDEKSCSNNFKCKMSGEYIPLTTKCDGRFDCFDYSDE
CNDECNNQVMMFDNISYKVIAWIFGVSATVLNAITLFHGFRQYRELNTETAKINKVFVLL
ITIGDLLQGIFLLILSIGEQFFNKSTCVTQFEWTTSGLCTSLGVLSTIGSIVSLYSMTIL
SIIRANKVVKSSMIQPRDNVSRKIGTSLSLAVLSIISISTIISIIPLISYEDYFVEKLMY
DDNPLLVGAPGKFKHLRIIESYYGRIRGVFLKKAISWKEIRNLVKGLFANNEVTGKNIDF
YGSNGFCLFSYFVRGDTNFRVFSILILSLNLVCVFVIVICYVIITVISFRSSRSISKNSP
TEKNQSKLQRKITIIIMTDVLTWVPFIIICIVNYTELVDTTSWYSLFCVFFLRINCIINP
IGIYDESIFNWIKKLALKLKSGIETAWLFVQNFIDHKEIMNQNVGVDIEMVEMPPEHLKK
P
Download sequence
Identical sequences ML03596a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]