SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML038026a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML038026a-PA
Domain Number 1 Region: 22-161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-37
Family Type II thymidine kinase 0.0000569
Further Details:      
 
Domain Number 2 Region: 193-433
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000108
Family Methyltransferase 10 domain 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML038026a-PA
Sequence length 637
Comment pep supercontig:GCA_000226015.1:ML0380:167299:173962:-1 gene:ML038026a transcript:ML038026a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNQLRLRSLSLTSNKLIFSGQIQLILGPMFSGKTTELLRRIQRYSIAQAKCLLIKHSK
DDRYNNSFVITHDKRTISNEYIDKTTCSNLKTLRENINISEYECIGIDEAQFFSGLLEFC
DHAANLGIVVVVAALSGDFQRKAFGDVLQLIPLSEDVITLKSVCMSCYRAEASFSYRINT
DNREARKDYFTLNFKDPESLKILTCSLASQYFDLTLELPSNRLIPTLPLRLNYLLWIEDL
LSYHTTSNEVVGIDIGTGASAVYALLGYQKFGWKFLATETDTMCYESALNNVIINSFQDE
IVIKLVKKEGGKLQGNLGSDRYTFCMCNPPFFEDTDNMTGISRSPHRAAPKSVCTATPVE
VITTGGEEQFVGEMVRESIKLGTQVLWYTSMLGRKTSLDHILGMLSECGVKRVAVTEFKQ
GNTTRWGVAWSHEPSIPPLLSPNSKKVSTSYNFSTKNTTAQTIITKLQSTLAQLHVQVSR
CPDQSGGIEYCAWVTAAENTWAHNRRKRRKRGSQKRESDGNGSLTQSGKRHCSDEKSSEQ
TLRNDNQSSDTQNSIDIKSNSLAEKVDSSHSVLDITSSSVSESSKVCLFHCLLSVEESEE
GVSVDFTWIFGSDKDCLNQFCCFVAKSICNPDTGSCG
Download sequence
Identical sequences ML038026a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]